BLASTX nr result
ID: Papaver27_contig00056076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00056076 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509827.1| conserved hypothetical protein [Ricinus comm... 41 1e-06 >ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis] gi|223549726|gb|EEF51214.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 349 FQMHPMEEIQKTKFASIYMDGRADSWFFDYCSCKTSIPWSEFSNHLCR 492 FQ++ + QK AS+Y+ RAD W+ + + S W +FS LCR Sbjct: 132 FQLYSIPNEQKIDIASLYLGDRADIWYQGWQAQTRSSDWGKFSEELCR 179 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 158 PQLVNKN---QPRSIVGEQHTPPPSVHFETNRSIHGSPANSLKPAKLDFPRFDGENPRSW 328 P ++N+N Q R +G+ ++ ++ G + K++ F+G NPR W Sbjct: 70 PSIINRNINGQTRPQIGQSAAEFGQTNWNSSFGSMGG-----RIPKVELSHFEGNNPRLW 124 Query: 329 LRKCDRFFR 355 ++KC+++F+ Sbjct: 125 IKKCEKYFQ 133