BLASTX nr result
ID: Papaver27_contig00055197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00055197 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009742.1| Mitochondrial substrate carrier family prote... 59 9e-07 ref|XP_001751862.1| predicted protein [Physcomitrella patens] gi... 57 3e-06 ref|XP_003579063.1| PREDICTED: mitochondrial substrate carrier f... 56 6e-06 ref|XP_002311112.1| mitochondrial substrate carrier family prote... 55 8e-06 ref|XP_006410750.1| hypothetical protein EUTSA_v10016258mg [Eutr... 55 1e-05 ref|XP_006843289.1| hypothetical protein AMTR_s00080p00159740 [A... 55 1e-05 ref|XP_007009741.1| Mitochondrial substrate carrier family prote... 55 1e-05 ref|XP_007009740.1| Mitochondrial substrate carrier family prote... 55 1e-05 ref|XP_006293693.1| hypothetical protein CARUB_v10022650mg [Caps... 55 1e-05 gb|EMT03430.1| Phosphoinositide phospholipase C 6 [Aegilops taus... 55 1e-05 gb|EMS57551.1| Phosphoinositide phospholipase C 6 [Triticum urartu] 55 1e-05 ref|XP_002879576.1| mitochondrial substrate carrier family prote... 55 1e-05 ref|XP_002316345.1| mitochondrial substrate carrier family prote... 55 1e-05 gb|AAD21477.1| putative mitochondrial carrier protein [Arabidops... 55 1e-05 ref|NP_850252.1| S-adenosyl methionine transporter-like protein ... 55 1e-05 >ref|XP_007009742.1| Mitochondrial substrate carrier family protein isoform 3 [Theobroma cacao] gi|508726655|gb|EOY18552.1| Mitochondrial substrate carrier family protein isoform 3 [Theobroma cacao] Length = 876 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/54 (51%), Positives = 41/54 (75%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIPNK*LANFQGYVLIFKLHHTGQH 129 +TR+QASTL+FP+I +K PQIGVRGLYRGS+P L F + ++F ++++ H Sbjct: 583 KTRVQASTLTFPEIISKLPQIGVRGLYRGSVP-AILGQFSRFCIVFIVYYSFFH 635 >ref|XP_001751862.1| predicted protein [Physcomitrella patens] gi|162696960|gb|EDQ83297.1| predicted protein [Physcomitrella patens] Length = 496 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK PQIGVRG+YRGSIP Sbjct: 248 KTRVQASTLSFPEVIAKLPQIGVRGMYRGSIP 279 >ref|XP_003579063.1| PREDICTED: mitochondrial substrate carrier family protein C-like [Brachypodium distachyon] Length = 729 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK PQIG+RGLYRGSIP Sbjct: 468 KTRVQASTLSFPELIAKLPQIGLRGLYRGSIP 499 >ref|XP_002311112.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222850932|gb|EEE88479.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 842 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTL+FP+I +K PQIGVRGLYRGSIP Sbjct: 588 KTRVQASTLTFPEIISKLPQIGVRGLYRGSIP 619 >ref|XP_006410750.1| hypothetical protein EUTSA_v10016258mg [Eutrema salsugineum] gi|557111919|gb|ESQ52203.1| hypothetical protein EUTSA_v10016258mg [Eutrema salsugineum] Length = 816 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK P+IGVRG+YRGSIP Sbjct: 559 KTRVQASTLSFPEVIAKLPEIGVRGVYRGSIP 590 >ref|XP_006843289.1| hypothetical protein AMTR_s00080p00159740 [Amborella trichopoda] gi|548845573|gb|ERN04964.1| hypothetical protein AMTR_s00080p00159740 [Amborella trichopoda] Length = 905 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK PQIG++GLYRGSIP Sbjct: 646 KTRVQASTLSFPELIAKLPQIGIQGLYRGSIP 677 >ref|XP_007009741.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] gi|508726654|gb|EOY18551.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] Length = 839 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTL+FP+I +K PQIGVRGLYRGS+P Sbjct: 583 KTRVQASTLTFPEIISKLPQIGVRGLYRGSVP 614 >ref|XP_007009740.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] gi|508726653|gb|EOY18550.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] Length = 842 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTL+FP+I +K PQIGVRGLYRGS+P Sbjct: 583 KTRVQASTLTFPEIISKLPQIGVRGLYRGSVP 614 >ref|XP_006293693.1| hypothetical protein CARUB_v10022650mg [Capsella rubella] gi|482562401|gb|EOA26591.1| hypothetical protein CARUB_v10022650mg [Capsella rubella] Length = 821 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK P+IGVRG+YRGSIP Sbjct: 564 KTRVQASTLSFPEVIAKLPEIGVRGVYRGSIP 595 >gb|EMT03430.1| Phosphoinositide phospholipase C 6 [Aegilops tauschii] Length = 1269 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK PQIG++GLYRGSIP Sbjct: 1008 KTRVQASTLSFPELIAKLPQIGIQGLYRGSIP 1039 >gb|EMS57551.1| Phosphoinositide phospholipase C 6 [Triticum urartu] Length = 1087 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK PQIG++GLYRGSIP Sbjct: 826 KTRVQASTLSFPELIAKLPQIGIQGLYRGSIP 857 >ref|XP_002879576.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297325415|gb|EFH55835.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 819 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK P+IGVRG+YRGSIP Sbjct: 562 KTRVQASTLSFPEVIAKLPEIGVRGVYRGSIP 593 >ref|XP_002316345.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222865385|gb|EEF02516.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 798 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTL+FP+I +K PQ+GVRGLYRGSIP Sbjct: 549 KTRVQASTLAFPEIISKLPQVGVRGLYRGSIP 580 >gb|AAD21477.1| putative mitochondrial carrier protein [Arabidopsis thaliana] Length = 844 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK P+IGVRG+YRGSIP Sbjct: 566 KTRVQASTLSFPEVIAKLPEIGVRGVYRGSIP 597 >ref|NP_850252.1| S-adenosyl methionine transporter-like protein [Arabidopsis thaliana] gi|17380984|gb|AAL36304.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|20466023|gb|AAM20346.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|330254069|gb|AEC09163.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] Length = 823 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 290 QTRLQASTLSFPDISAKFPQIGVRGLYRGSIP 195 +TR+QASTLSFP++ AK P+IGVRG+YRGSIP Sbjct: 566 KTRVQASTLSFPEVIAKLPEIGVRGVYRGSIP 597