BLASTX nr result
ID: Papaver27_contig00054367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00054367 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204958.1| hypothetical protein PRUPE_ppa000648mg [Prun... 59 7e-07 >ref|XP_007204958.1| hypothetical protein PRUPE_ppa000648mg [Prunus persica] gi|462400600|gb|EMJ06157.1| hypothetical protein PRUPE_ppa000648mg [Prunus persica] Length = 1052 Score = 58.9 bits (141), Expect = 7e-07 Identities = 38/82 (46%), Positives = 45/82 (54%), Gaps = 4/82 (4%) Frame = +2 Query: 17 LSGTPGVPLWY----LVLELNFHPEGLSNL*SFVVANEIAEEDKGLIARNRTTQSVSDVS 184 L G G P W LVLEL +H EGLSN S +VAN+I +ED + V DVS Sbjct: 955 LDGRKGTPPWEQLRDLVLELEYHLEGLSNRPSLIVANKI-DEDGAEEVYEELKRRVQDVS 1013 Query: 185 IFPFLQSWKEGLAGLKVGLRFL 250 IFP +EG+ LK GLR L Sbjct: 1014 IFPVCAVLEEGVPELKTGLRML 1035