BLASTX nr result
ID: Papaver27_contig00053926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00053926 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840479.1| hypothetical protein AMTR_s00045p00186460 [A... 57 2e-06 gb|AHG94617.1| sugar transporter [Camellia sinensis] 55 8e-06 >ref|XP_006840479.1| hypothetical protein AMTR_s00045p00186460 [Amborella trichopoda] gi|548842197|gb|ERN02154.1| hypothetical protein AMTR_s00045p00186460 [Amborella trichopoda] Length = 271 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 1 VWFFYAVLVGDPFVGVPNGVGFIFGIVQLALYARYR 108 VWF Y++LVGD F+GVPNG+GFI G QL +YA YR Sbjct: 170 VWFLYSLLVGDFFIGVPNGIGFILGATQLIVYAVYR 205 >gb|AHG94617.1| sugar transporter [Camellia sinensis] Length = 240 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +1 Query: 1 VWFFYAVLVGDPFVGVPNGVGFIFGIVQLALYARY 105 +W FYAVLV D F+GVPNG GFI GI QL LYA Y Sbjct: 174 IWAFYAVLVHDLFLGVPNGTGFILGIAQLVLYAIY 208