BLASTX nr result
ID: Papaver27_contig00052565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00052565 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319150.2| C2 domain-containing family protein [Populus... 76 6e-12 ref|XP_004166136.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 74 2e-11 ref|XP_004149122.1| PREDICTED: uncharacterized protein LOC101222... 74 2e-11 ref|XP_006358735.1| PREDICTED: uncharacterized protein LOC102604... 74 2e-11 ref|XP_006400340.1| hypothetical protein EUTSA_v10012529mg [Eutr... 72 6e-11 ref|XP_004229283.1| PREDICTED: uncharacterized protein LOC101268... 72 8e-11 ref|XP_006344598.1| PREDICTED: uncharacterized protein LOC102579... 72 1e-10 ref|XP_006286355.1| hypothetical protein CARUB_v10000107mg [Caps... 71 1e-10 ref|XP_002871792.1| C2 domain-containing protein [Arabidopsis ly... 71 2e-10 ref|XP_004489683.1| PREDICTED: uncharacterized protein LOC101501... 70 2e-10 ref|XP_002525723.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|NP_197299.1| C2 calcium/lipid-binding and phosphoribosyltran... 70 3e-10 ref|XP_006479137.1| PREDICTED: uncharacterized protein LOC102628... 70 4e-10 ref|XP_007030058.1| C2 calcium/lipid-binding plant phosphoribosy... 69 5e-10 ref|XP_003542167.1| PREDICTED: uncharacterized protein LOC100787... 69 5e-10 ref|XP_006443454.1| hypothetical protein CICLE_v10018633mg [Citr... 68 1e-09 gb|EYU18176.1| hypothetical protein MIMGU_mgv1a000714mg [Mimulus... 66 4e-09 ref|XP_004294491.1| PREDICTED: uncharacterized protein LOC101292... 66 6e-09 ref|XP_007145964.1| hypothetical protein PHAVU_006G001700g [Phas... 65 1e-08 ref|XP_006842117.1| hypothetical protein AMTR_s00078p00102770 [A... 65 1e-08 >ref|XP_002319150.2| C2 domain-containing family protein [Populus trichocarpa] gi|550325008|gb|EEE95073.2| C2 domain-containing family protein [Populus trichocarpa] Length = 1040 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 G K+ L+VEV+DAR+LLPKDGHG+SSPYVV+DFYGQRKRT+S Sbjct: 2 GTKQKLIVEVVDARNLLPKDGHGSSSPYVVIDFYGQRKRTKS 43 >ref|XP_004166136.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101227141 [Cucumis sativus] Length = 1043 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 G R L+VEV+DAR+LLPKDGHG+SSPY+VVD+YGQRKRTR+I Sbjct: 4 GQLRKLIVEVVDARNLLPKDGHGSSSPYIVVDYYGQRKRTRTI 46 >ref|XP_004149122.1| PREDICTED: uncharacterized protein LOC101222743 [Cucumis sativus] Length = 1057 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 G R L+VEV+DAR+LLPKDGHG+SSPY+VVD+YGQRKRTR+I Sbjct: 4 GQLRKLIVEVVDARNLLPKDGHGSSSPYIVVDYYGQRKRTRTI 46 >ref|XP_006358735.1| PREDICTED: uncharacterized protein LOC102604455 [Solanum tuberosum] Length = 995 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 G+ R LVVEVI+AR+LLPKDGHGTSSPYV VDFYGQR++TR++ Sbjct: 2 GIVRKLVVEVIEARNLLPKDGHGTSSPYVFVDFYGQRRKTRTV 44 >ref|XP_006400340.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum] gi|557101430|gb|ESQ41793.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum] Length = 1064 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 261 VKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 V R LVVEV+DA+ L PKDGHGTSSPYVVVD+YGQR+RTR+I Sbjct: 3 VTRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTI 44 >ref|XP_004229283.1| PREDICTED: uncharacterized protein LOC101268027 [Solanum lycopersicum] Length = 992 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 G R LVVEV +AR+LLPKDGHGTSSPYVVVDFYGQR++TR + Sbjct: 2 GTVRKLVVEVTEARNLLPKDGHGTSSPYVVVDFYGQRRKTRPV 44 >ref|XP_006344598.1| PREDICTED: uncharacterized protein LOC102579397 [Solanum tuberosum] Length = 1020 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 G R LVVEVI+AR+LLPKDGHGTSSPYV+VDF+GQR++TR++ Sbjct: 2 GTVRKLVVEVIEARNLLPKDGHGTSSPYVLVDFHGQRRKTRTV 44 >ref|XP_006286355.1| hypothetical protein CARUB_v10000107mg [Capsella rubella] gi|482555061|gb|EOA19253.1| hypothetical protein CARUB_v10000107mg [Capsella rubella] Length = 1055 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 R LVVEV+DA+ L PKDGHGTSSPYVVVD+YGQR+RTR+I Sbjct: 5 RKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTI 44 >ref|XP_002871792.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317629|gb|EFH48051.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1053 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 R LVVEV+DA+ L PKDGHGTSSPYV+VD+YGQR+RTR+I Sbjct: 5 RKLVVEVVDAKDLTPKDGHGTSSPYVIVDYYGQRRRTRTI 44 >ref|XP_004489683.1| PREDICTED: uncharacterized protein LOC101501960 [Cicer arietinum] Length = 1022 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 258 GVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 G R L+VEVIDA++L PKDGHGTSSPY+VVDFYGQR++TR+ Sbjct: 2 GTIRKLIVEVIDAQNLAPKDGHGTSSPYIVVDFYGQRRKTRT 43 >ref|XP_002525723.1| conserved hypothetical protein [Ricinus communis] gi|223535023|gb|EEF36706.1| conserved hypothetical protein [Ricinus communis] Length = 1074 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 273 LVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 L+VEV+DAR+LLPKDGHGTSSPYV +DFYGQRKRT++ Sbjct: 7 LIVEVVDARNLLPKDGHGTSSPYVTIDFYGQRKRTQT 43 >ref|NP_197299.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal domain-containing protein [Arabidopsis thaliana] gi|9757890|dbj|BAB08397.1| phosphoribosylanthranilate transferase-like protein [Arabidopsis thaliana] gi|332005109|gb|AED92492.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal domain-containing protein [Arabidopsis thaliana] Length = 1049 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 R LVVEV+DA+ L PKDGHGTSSPYVV+D+YGQR+RTR+I Sbjct: 5 RKLVVEVVDAKDLTPKDGHGTSSPYVVLDYYGQRRRTRTI 44 >ref|XP_006479137.1| PREDICTED: uncharacterized protein LOC102628142 [Citrus sinensis] Length = 1065 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/45 (66%), Positives = 41/45 (91%) Frame = +3 Query: 249 KMGGVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 KM +++L +VEV+DAR+LLPKDGHGTSSPYVV+D+YGQR++T + Sbjct: 2 KMAAIQKL-IVEVVDARNLLPKDGHGTSSPYVVIDYYGQRRKTHT 45 >ref|XP_007030058.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family protein [Theobroma cacao] gi|508718663|gb|EOY10560.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family protein [Theobroma cacao] Length = 1045 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +3 Query: 252 MGGVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 M + LVVEVIDAR+L+PKDGHG SSPYVV+D+YGQRKRT ++ Sbjct: 1 MATTTQKLVVEVIDARNLVPKDGHGASSPYVVIDYYGQRKRTSTV 45 >ref|XP_003542167.1| PREDICTED: uncharacterized protein LOC100787960 [Glycine max] Length = 1009 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +3 Query: 252 MGGVKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 MG V++L +VEV+DA +L+PKDGHGTSSPYVVVDF+GQR++TR+ Sbjct: 1 MGSVRKL-IVEVVDAHNLVPKDGHGTSSPYVVVDFHGQRRKTRT 43 >ref|XP_006443454.1| hypothetical protein CICLE_v10018633mg [Citrus clementina] gi|557545716|gb|ESR56694.1| hypothetical protein CICLE_v10018633mg [Citrus clementina] Length = 1063 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = +3 Query: 273 LVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 L+VEV+DAR+LLPKDGHGTSSPYVV+D+YGQR++T + Sbjct: 7 LIVEVVDARNLLPKDGHGTSSPYVVIDYYGQRRKTHT 43 >gb|EYU18176.1| hypothetical protein MIMGU_mgv1a000714mg [Mimulus guttatus] Length = 1009 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/41 (68%), Positives = 38/41 (92%) Frame = +3 Query: 261 VKRLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 + R LVVEV+DAR+LLPKDG+GTSSPY ++DF+GQR++TR+ Sbjct: 3 IVRKLVVEVVDARNLLPKDGYGTSSPYAILDFHGQRRKTRT 43 >ref|XP_004294491.1| PREDICTED: uncharacterized protein LOC101292876 [Fragaria vesca subsp. vesca] Length = 1040 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 R L+VEV+DAR L PKDGHGT SPYV VD+YGQRKRT+++ Sbjct: 5 RKLIVEVVDARDLPPKDGHGTVSPYVQVDYYGQRKRTQTV 44 >ref|XP_007145964.1| hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris] gi|561019187|gb|ESW17958.1| hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris] Length = 1013 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRS 383 R L+VEV+DA L+PKDGHG+SSPYVVVD YGQR++TR+ Sbjct: 5 RKLIVEVVDAHHLVPKDGHGSSSPYVVVDIYGQRRKTRT 43 >ref|XP_006842117.1| hypothetical protein AMTR_s00078p00102770 [Amborella trichopoda] gi|548844166|gb|ERN03792.1| hypothetical protein AMTR_s00078p00102770 [Amborella trichopoda] Length = 1098 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 267 RLLVVEVIDARSLLPKDGHGTSSPYVVVDFYGQRKRTRSI 386 R L+VEV+DAR LLPKDG G+SSPYVVVDF GQRKRT+++ Sbjct: 4 RRLIVEVVDARDLLPKDGLGSSSPYVVVDFDGQRKRTKTV 43