BLASTX nr result
ID: Papaver27_contig00052165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00052165 (783 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494201.1| PREDICTED: biotin synthase-like [Citrus sine... 74 5e-11 ref|XP_006494187.1| PREDICTED: biotin synthase-like [Citrus sine... 74 5e-11 ref|XP_006443087.1| hypothetical protein CICLE_v10020553mg [Citr... 74 5e-11 ref|XP_006397503.1| hypothetical protein EUTSA_v10001495mg [Eutr... 74 8e-11 ref|XP_006397502.1| hypothetical protein EUTSA_v10001495mg [Eutr... 74 8e-11 gb|EXB68681.1| Biotin synthase [Morus notabilis] 73 1e-10 ref|XP_006372914.1| Biotin synthase family protein [Populus tric... 73 1e-10 ref|NP_181864.1| biotin synthase [Arabidopsis thaliana] gi|17054... 73 1e-10 ref|XP_006294408.1| hypothetical protein CARUB_v10023426mg [Caps... 73 1e-10 gb|AAO41898.1| putative biotin synthase (Bio B) [Arabidopsis tha... 73 1e-10 ref|XP_007223123.1| hypothetical protein PRUPE_ppa007144mg [Prun... 72 2e-10 ref|XP_003537735.1| PREDICTED: biotin synthase-like [Glycine max] 72 2e-10 ref|XP_007131558.1| hypothetical protein PHAVU_011G023300g [Phas... 72 2e-10 ref|XP_007131557.1| hypothetical protein PHAVU_011G023300g [Phas... 72 2e-10 ref|XP_004296725.1| PREDICTED: biotin synthase-like [Fragaria ve... 72 2e-10 ref|NP_001237227.1| biotin synthase [Glycine max] gi|82393851|gb... 72 2e-10 gb|ACU18888.1| unknown [Glycine max] 72 2e-10 ref|XP_002310445.1| Biotin synthase family protein [Populus tric... 72 2e-10 gb|AAX28926.1| biotin synthase [Raphanus sativus] 72 3e-10 ref|XP_002881898.1| hypothetical protein ARALYDRAFT_903720 [Arab... 72 3e-10 >ref|XP_006494201.1| PREDICTED: biotin synthase-like [Citrus sinensis] Length = 217 Score = 74.3 bits (181), Expect = 5e-11 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL LT Sbjct: 130 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLT 189 >ref|XP_006494187.1| PREDICTED: biotin synthase-like [Citrus sinensis] Length = 219 Score = 74.3 bits (181), Expect = 5e-11 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL LT Sbjct: 133 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLT 192 >ref|XP_006443087.1| hypothetical protein CICLE_v10020553mg [Citrus clementina] gi|567901200|ref|XP_006443088.1| hypothetical protein CICLE_v10020553mg [Citrus clementina] gi|557545349|gb|ESR56327.1| hypothetical protein CICLE_v10020553mg [Citrus clementina] gi|557545350|gb|ESR56328.1| hypothetical protein CICLE_v10020553mg [Citrus clementina] Length = 386 Score = 74.3 bits (181), Expect = 5e-11 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL LT Sbjct: 300 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLT 359 >ref|XP_006397503.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] gi|557098576|gb|ESQ38956.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] Length = 377 Score = 73.6 bits (179), Expect = 8e-11 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS + QALCFLAGA S+FT + L +NDFDA+Q++FK L LT Sbjct: 294 IVMPKAMVRLSAGRVRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLT 353 >ref|XP_006397502.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] gi|567165333|ref|XP_006397504.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] gi|557098575|gb|ESQ38955.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] gi|557098577|gb|ESQ38957.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum] Length = 379 Score = 73.6 bits (179), Expect = 8e-11 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS + QALCFLAGA S+FT + L +NDFDA+Q++FK L LT Sbjct: 296 IVMPKAMVRLSAGRVRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLT 355 >gb|EXB68681.1| Biotin synthase [Morus notabilis] Length = 376 Score = 73.2 bits (178), Expect = 1e-10 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FK+L LT Sbjct: 290 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKLLGLT 349 >ref|XP_006372914.1| Biotin synthase family protein [Populus trichocarpa] gi|550319562|gb|ERP50711.1| Biotin synthase family protein [Populus trichocarpa] Length = 391 Score = 73.2 bits (178), Expect = 1e-10 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS S QALCFLAGA S+FT + L +ND+DA+Q++FKVL L Sbjct: 305 IVMPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGL 363 >ref|NP_181864.1| biotin synthase [Arabidopsis thaliana] gi|1705463|sp|P54967.1|BIOB_ARATH RecName: Full=Biotin synthase gi|1045316|gb|AAA80226.1| biotin sythase [Arabidopsis thaliana] gi|1403662|gb|AAC49445.1| BIO2 protein [Arabidopsis thaliana] gi|1769457|gb|AAB39953.1| biotin synthase [Arabidopsis thaliana] gi|2288983|gb|AAB64312.1| biotin synthase (Bio B) [Arabidopsis thaliana] gi|90093314|gb|ABD85170.1| At2g43360 [Arabidopsis thaliana] gi|330255162|gb|AEC10256.1| biotin synthase [Arabidopsis thaliana] gi|1589016|prf||2209438A biotin synthase Length = 378 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS S QALCFLAGA S+FT + L +NDFDA+Q++FK L L Sbjct: 295 IVMPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGL 353 >ref|XP_006294408.1| hypothetical protein CARUB_v10023426mg [Capsella rubella] gi|482563116|gb|EOA27306.1| hypothetical protein CARUB_v10023426mg [Capsella rubella] Length = 380 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FK L LT Sbjct: 297 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLT 356 >gb|AAO41898.1| putative biotin synthase (Bio B) [Arabidopsis thaliana] Length = 378 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS S QALCFLAGA S+FT + L +NDFDA+Q++FK L L Sbjct: 295 IVMPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGL 353 >ref|XP_007223123.1| hypothetical protein PRUPE_ppa007144mg [Prunus persica] gi|462420059|gb|EMJ24322.1| hypothetical protein PRUPE_ppa007144mg [Prunus persica] Length = 380 Score = 72.4 bits (176), Expect = 2e-10 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 294 IVMPKAMVRLSAGRVKFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 352 >ref|XP_003537735.1| PREDICTED: biotin synthase-like [Glycine max] Length = 374 Score = 72.4 bits (176), Expect = 2e-10 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 291 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 349 >ref|XP_007131558.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris] gi|561004558|gb|ESW03552.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris] Length = 280 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 ++MPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 197 IIMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 255 >ref|XP_007131557.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris] gi|561004557|gb|ESW03551.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris] Length = 374 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 ++MPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 291 IIMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 349 >ref|XP_004296725.1| PREDICTED: biotin synthase-like [Fragaria vesca subsp. vesca] Length = 388 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 302 IVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQVMFKVLGL 360 >ref|NP_001237227.1| biotin synthase [Glycine max] gi|82393851|gb|ABB72224.1| biotin synthase [Glycine max] Length = 374 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 ++MPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 291 IIMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 349 >gb|ACU18888.1| unknown [Glycine max] Length = 374 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 ++MPKA+ RLS+ RV FS QALCFLAGA S+FT + L +NDFDA+Q++FKVL L Sbjct: 291 IIMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGL 349 >ref|XP_002310445.1| Biotin synthase family protein [Populus trichocarpa] gi|222853348|gb|EEE90895.1| Biotin synthase family protein [Populus trichocarpa] Length = 382 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/59 (59%), Positives = 46/59 (77%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS + QALCFLAGA S+FT + L +ND+DA+Q++FKVL L Sbjct: 293 IVMPKAMVRLSAGRVSFSMAEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGL 351 >gb|AAX28926.1| biotin synthase [Raphanus sativus] Length = 214 Score = 71.6 bits (174), Expect = 3e-10 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWLT 192 +VMPKA+ RLS+ RV F+ QALCFLAGA S+FT + L +NDFDA+Q++FK L LT Sbjct: 131 IVMPKAMVRLSAGRVRFTMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLT 190 >ref|XP_002881898.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp. lyrata] gi|297327737|gb|EFH58157.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp. lyrata] Length = 377 Score = 71.6 bits (174), Expect = 3e-10 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -2 Query: 371 VVMPKAIFRLSSSRV*FSKSNQALCFLAGAYSVFTSDFFLAAFSNDFDAEQMIFKVLWL 195 +VMPKA+ RLS+ RV FS + QALCFLAGA S+FT + L +NDFDA+Q++FK L L Sbjct: 294 IVMPKAMVRLSAGRVRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGL 352