BLASTX nr result
ID: Papaver27_contig00050636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00050636 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] 57 3e-06 >ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vitis vinifera] Length = 474 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 483 VLSNMYADAGSWADVLRLREEMKDGGVKKILGWSLVNGN 367 VLSNMYA+AG W DVLRLR+ MK G +KK GWSLV+ + Sbjct: 435 VLSNMYAEAGRWEDVLRLRKVMKSGNLKKTPGWSLVDSD 473 >emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] Length = 476 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 483 VLSNMYADAGSWADVLRLREEMKDGGVKKILGWSLVNGN 367 VLSNMYA+AG W DVLRLR+ MK G +KK GWSLV+ + Sbjct: 437 VLSNMYAEAGRWEDVLRLRKVMKSGNLKKTPGWSLVDSD 475