BLASTX nr result
ID: Papaver27_contig00050342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00050342 (1097 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842741.1| hypothetical protein AMTR_s00133p00052350 [A... 48 1e-06 ref|XP_004236171.1| PREDICTED: HIPL1 protein-like [Solanum lycop... 50 8e-06 >ref|XP_006842741.1| hypothetical protein AMTR_s00133p00052350 [Amborella trichopoda] gi|548844855|gb|ERN04416.1| hypothetical protein AMTR_s00133p00052350 [Amborella trichopoda] Length = 706 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 23/50 (46%), Positives = 28/50 (56%) Frame = +3 Query: 213 RFSVLSMSGKEELNSLRILGYYSIPTFSQHMLDKDSLPDIWALGSSNPWR 362 R V M E++ LR+ G YSIP + D S P+IWALG NPWR Sbjct: 429 RLDVDKMPSATEIDDLRLWGNYSIPKDNPFSQDNKSQPEIWALGLRNPWR 478 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +1 Query: 364 CSLDLQKPSYFLCVDPAKVGS*FY 435 CS DL++PSYF+C D VG FY Sbjct: 479 CSFDLERPSYFVCAD---VGQEFY 499 >ref|XP_004236171.1| PREDICTED: HIPL1 protein-like [Solanum lycopersicum] Length = 683 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 23/50 (46%), Positives = 30/50 (60%) Frame = +3 Query: 213 RFSVLSMSGKEELNSLRILGYYSIPTFSQHMLDKDSLPDIWALGSSNPWR 362 R V S EE+ L + G Y+IP + ++ DKD P+IWALG NPWR Sbjct: 414 RLDVDSTPSAEEITKLALWGNYTIPKDNPYIEDKDLQPEIWALGMRNPWR 463 Score = 27.3 bits (59), Expect(2) = 8e-06 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 364 CSLDLQKPSYFLCVD 408 CS D +PSYF+C D Sbjct: 464 CSFDSARPSYFMCAD 478