BLASTX nr result
ID: Papaver27_contig00049899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00049899 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219682.1| hypothetical protein PRUPE_ppa025483mg [Prun... 59 7e-07 gb|EXB92318.1| ATP-dependent RNA helicase dhx8 [Morus notabilis] 57 3e-06 ref|XP_007211002.1| hypothetical protein PRUPE_ppa020858mg [Prun... 57 3e-06 >ref|XP_007219682.1| hypothetical protein PRUPE_ppa025483mg [Prunus persica] gi|462416144|gb|EMJ20881.1| hypothetical protein PRUPE_ppa025483mg [Prunus persica] Length = 407 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/55 (47%), Positives = 35/55 (63%) Frame = +1 Query: 232 TLHDYMYPARIRMSSYIVLPQTDGLFELSANKIQMLPIYRGVESENPYHHVREFE 396 TLHDY++PAR + S I+ P F+ IQ+LP + ++ ENPY HVREFE Sbjct: 29 TLHDYLHPARTSVPSCIIFPLNGQNFDFKPGMIQLLPTFHEMKYENPYSHVREFE 83 >gb|EXB92318.1| ATP-dependent RNA helicase dhx8 [Morus notabilis] Length = 941 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = +1 Query: 232 TLHDYMYPARIRMSSYIVLPQTDGLFELSANKIQMLPIYRGVESENPYHHVREFE 396 TL+DY++P R S I+ P + + IQ+LP + G+ESENPY H+REFE Sbjct: 619 TLNDYLHPTRTATPSCIMFPPNMPNLDFNPGMIQLLPTFHGLESENPYVHIREFE 673 >ref|XP_007211002.1| hypothetical protein PRUPE_ppa020858mg [Prunus persica] gi|462406737|gb|EMJ12201.1| hypothetical protein PRUPE_ppa020858mg [Prunus persica] Length = 421 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/55 (45%), Positives = 34/55 (61%) Frame = +1 Query: 232 TLHDYMYPARIRMSSYIVLPQTDGLFELSANKIQMLPIYRGVESENPYHHVREFE 396 TLHDY++P + S I+ P F + I++LP + G+ESEN Y HVREFE Sbjct: 41 TLHDYLHPTCTSVPSCIIFPLNGQTFYFKSGMIRLLPTFHGMESENSYSHVREFE 95