BLASTX nr result
ID: Papaver27_contig00048188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00048188 (651 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlise... 62 2e-07 ref|XP_003567241.1| PREDICTED: gamma-interferon-inducible lysoso... 62 2e-07 ref|XP_004970433.1| PREDICTED: gamma-interferon-inducible lysoso... 60 4e-07 ref|XP_002456575.1| hypothetical protein SORBIDRAFT_03g038650 [S... 60 4e-07 ref|XP_006847417.1| hypothetical protein AMTR_s00153p00064140 [A... 60 8e-07 dbj|BAD73620.1| putative legumaturain [Oryza sativa Japonica Gro... 59 1e-06 gb|EAY76352.1| hypothetical protein OsI_04287 [Oryza sativa Indi... 59 1e-06 gb|EMT22579.1| hypothetical protein F775_21058 [Aegilops tauschii] 58 3e-06 ref|XP_002863285.1| gamma interferon responsive lysosomal thiol ... 57 4e-06 ref|XP_004294784.1| PREDICTED: gamma-interferon-inducible lysoso... 57 5e-06 ref|XP_002965810.1| hypothetical protein SELMODRAFT_406875 [Sela... 57 5e-06 ref|XP_002993226.1| hypothetical protein SELMODRAFT_162916 [Sela... 57 5e-06 ref|XP_002863283.1| hypothetical protein ARALYDRAFT_497109 [Arab... 57 6e-06 emb|CAN76153.1| hypothetical protein VITISV_012675 [Vitis vinifera] 57 6e-06 ref|XP_006649924.1| PREDICTED: gamma-interferon-inducible lysoso... 56 8e-06 gb|EPS58984.1| hypothetical protein M569_15829 [Genlisea aurea] 56 8e-06 ref|XP_007026600.1| Gamma interferon responsive lysosomal thiol ... 56 8e-06 gb|EMS56591.1| hypothetical protein TRIUR3_02402 [Triticum urartu] 56 8e-06 ref|NP_001140474.1| hypothetical protein precursor [Zea mays] gi... 56 8e-06 >gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlisea aurea] Length = 200 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP C++F+++ LSKIF+NRL D+VDL L+P+GN +L N CQ Sbjct: 17 SLCPYCADFIVNKLSKIFQNRLIDVVDLRLIPWGNTHILPNSTWACQ 63 >ref|XP_003567241.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Brachypodium distachyon] Length = 243 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF+N LS IVDL LVP+GN + +G + CQ Sbjct: 39 TLCPFCSGFVVNDLARIFQNGLSSIVDLRLVPFGNGRVSPDGSMTCQ 85 >ref|XP_004970433.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Setaria italica] Length = 242 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS FV++DL++IF N +S I DL LVP+GN + +G I CQ Sbjct: 29 VTVSVYYETLCPFCSAFVVNDLARIFNNGVSSIADLRLVPFGNGRVSADGSITCQ 83 >ref|XP_002456575.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor] gi|241928550|gb|EES01695.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor] Length = 232 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DLS++F N +S I DL LVP+GN + +G I CQ Sbjct: 38 TLCPFCSAFVVNDLSRVFRNGISSIADLRLVPFGNGRVSADGTITCQ 84 >ref|XP_006847417.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda] gi|548850583|gb|ERN08998.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda] Length = 241 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++ L K+F N L DIVDL L+PYGNA + N I CQ Sbjct: 36 TLCPYCSRFVVNYLGKMFSNGLIDIVDLRLIPYGNAWIGSNNTISCQ 82 >dbj|BAD73620.1| putative legumaturain [Oryza sativa Japonica Group] gi|125572499|gb|EAZ14014.1| hypothetical protein OsJ_03939 [Oryza sativa Japonica Group] Length = 246 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF + LS +VDL LVP+GN + +G I CQ Sbjct: 7 TLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQ 53 >gb|EAY76352.1| hypothetical protein OsI_04287 [Oryza sativa Indica Group] Length = 246 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF + LS +VDL LVP+GN + +G I CQ Sbjct: 7 TLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQ 53 >gb|EMT22579.1| hypothetical protein F775_21058 [Aegilops tauschii] Length = 240 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF N LS VDL LVP+GN + +G + CQ Sbjct: 37 TLCPFCSGFVVNDLARIFRNGLSSNVDLRLVPFGNGRVSPDGSMSCQ 83 >ref|XP_002863285.1| gamma interferon responsive lysosomal thiol reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297309119|gb|EFH39544.1| gamma interferon responsive lysosomal thiol reductase family protein [Arabidopsis lyrata subsp. lyrata] Length = 232 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP C F++HDL KIF++ L I DL LVP+GNA + N I CQ Sbjct: 46 SLCPYCQNFIVHDLGKIFDSDLLKITDLKLVPFGNAHVSNNLTITCQ 92 >ref|XP_004294784.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform 2 [Fragaria vesca subsp. vesca] Length = 259 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS+F++ L K+F+ L VDLNLVPYGNA + N I CQ Sbjct: 41 TLCPDCSDFMIKHLIKLFDTGLISAVDLNLVPYGNAKVGPNSTITCQ 87 >ref|XP_002965810.1| hypothetical protein SELMODRAFT_406875 [Selaginella moellendorffii] gi|300166624|gb|EFJ33230.1| hypothetical protein SELMODRAFT_406875 [Selaginella moellendorffii] Length = 234 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP C+ FV++ LSK F N L +IVDL ++PYGNA + +G I CQ Sbjct: 45 SLCPFCANFVVNYLSKFFTNGLIEIVDLKIIPYGNARMDSSGHITCQ 91 >ref|XP_002993226.1| hypothetical protein SELMODRAFT_162916 [Selaginella moellendorffii] gi|300138996|gb|EFJ05746.1| hypothetical protein SELMODRAFT_162916 [Selaginella moellendorffii] Length = 236 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP C+ FV++ LSK F N L +IVDL ++PYGNA + +G I CQ Sbjct: 47 SLCPFCANFVVNYLSKFFTNGLIEIVDLKIIPYGNARMDSSGHITCQ 93 >ref|XP_002863283.1| hypothetical protein ARALYDRAFT_497109 [Arabidopsis lyrata subsp. lyrata] gi|297309117|gb|EFH39542.1| hypothetical protein ARALYDRAFT_497109 [Arabidopsis lyrata subsp. lyrata] Length = 223 Score = 56.6 bits (135), Expect = 6e-06 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 5/89 (5%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ-----V*FKCLFP 311 +LCP C EF++ DLSKIF+ L I L LVP+GNA L N I CQ L Sbjct: 40 SLCPGCQEFIVDDLSKIFDYDLYTITHLKLVPFGNAKLSDNLTITCQHGEEECKLNALEA 99 Query: 312 AGRRRQLDEVMIQGRVKCNFSILLGNLEI 398 R D + IQG++ S L++ Sbjct: 100 CAIRTWPDPIFIQGQLNVRISFWQITLDV 128 >emb|CAN76153.1| hypothetical protein VITISV_012675 [Vitis vinifera] Length = 114 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 2/50 (4%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENR--LSDIVDLNLVPYGNADLLKNGKIICQV 290 TLCP CS F+++ L K+F N L IVDL L+PYGNA + NG I CQV Sbjct: 45 TLCPYCSNFIVNHLIKLFNNGDGLVSIVDLKLLPYGNAKIGPNGTITCQV 94 >ref|XP_006649924.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X1 [Oryza brachyantha] Length = 259 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP CS F+++ L+ IFE+ L D VDL LVPYGNA + N I CQ Sbjct: 40 SLCPYCSRFIVNHLAGIFEDGLIDAVDLRLVPYGNAHVGANNTISCQ 86 >gb|EPS58984.1| hypothetical protein M569_15829 [Genlisea aurea] Length = 96 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/54 (50%), Positives = 38/54 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQV*FKCLF 308 TLCP CS +++ L KIFE+ L I +L L+PYGNA ++NG I+CQ +C+F Sbjct: 33 TLCPYCSNLIVNYLYKIFESDLISITNLRLIPYGNAK-IRNGTIVCQ---ECIF 82 >ref|XP_007026600.1| Gamma interferon responsive lysosomal thiol reductase family protein, putative [Theobroma cacao] gi|508715205|gb|EOY07102.1| Gamma interferon responsive lysosomal thiol reductase family protein, putative [Theobroma cacao] Length = 249 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/47 (46%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP C++F+++ L K+F+ L+ IV+L LVP+GNA + ++G +CQ Sbjct: 38 TLCPYCADFIVNHLVKLFDKGLNSIVNLRLVPWGNAVMQRDGNFVCQ 84 >gb|EMS56591.1| hypothetical protein TRIUR3_02402 [Triticum urartu] Length = 249 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV+++L++IF N LS VDL LVP+GN +G + CQ Sbjct: 37 TLCPFCSGFVVNELARIFRNGLSSNVDLRLVPFGNGRFSPDGSMTCQ 83 >ref|NP_001140474.1| hypothetical protein precursor [Zea mays] gi|194699650|gb|ACF83909.1| unknown [Zea mays] gi|413952062|gb|AFW84711.1| hypothetical protein ZEAMMB73_074099 [Zea mays] Length = 237 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DLS+IF + + I DL LVP+GN + +G + CQ Sbjct: 43 TLCPFCSAFVVNDLSRIFRDGIFSIADLRLVPFGNGRVSADGTVTCQ 89