BLASTX nr result
ID: Papaver27_contig00047987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00047987 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006837928.1| hypothetical protein AMTR_s00353p00013170 [A... 55 8e-06 >ref|XP_006837928.1| hypothetical protein AMTR_s00353p00013170 [Amborella trichopoda] gi|548840341|gb|ERN00497.1| hypothetical protein AMTR_s00353p00013170 [Amborella trichopoda] Length = 141 Score = 55.5 bits (132), Expect = 8e-06 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 10/104 (9%) Frame = +3 Query: 30 YFVM*PHTRLLKLLVSFPNVDHYHHLHHHQMIFSL-------VH*LVTCFLVTMNLLKAW 188 Y + PH RLL L F ++ H+HHLHHH ++ S +H L+ + + ++L Sbjct: 2 YTSLHPHRRLLHHLHIFISL-HHHHLHHHPLLISTSLPHHHHLHHLLLMYTILLHLHPHH 60 Query: 189 E---SS*YFVM*LHTHLLKLLVFFRNVDHYHHLHHHQMSFSLIH 311 +S + LH HL LL F + H+HHLHH MS SL+H Sbjct: 61 HHLLTSTSLHLHLH-HLHHLLTFTSPLHHHHHLHHLLMSTSLLH 103