BLASTX nr result
ID: Papaver27_contig00047458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00047458 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277551.2| PREDICTED: uncharacterized protein At5g19025... 72 8e-11 emb|CBI26176.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002516787.1| 60S ribosomal protein L34, putative [Ricinus... 70 4e-10 ref|XP_006489287.1| PREDICTED: uncharacterized protein At5g19025... 68 1e-09 ref|XP_006419801.1| hypothetical protein CICLE_v10005941mg [Citr... 68 1e-09 ref|XP_004169520.1| PREDICTED: uncharacterized protein At5g19025... 68 2e-09 ref|XP_004296951.1| PREDICTED: uncharacterized protein At5g19025... 65 1e-08 ref|NP_187269.1| ribosomal protein L34e superfamily protein [Ara... 65 1e-08 ref|XP_004150326.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002882453.1| hypothetical protein ARALYDRAFT_896728 [Arab... 64 3e-08 ref|XP_002314419.2| hypothetical protein POPTR_0010s03100g [Popu... 62 8e-08 ref|XP_007034587.1| Ribosomal protein L34e superfamily protein i... 62 1e-07 emb|CAN71157.1| hypothetical protein VITISV_036761 [Vitis vinifera] 57 4e-06 gb|EXB95838.1| Uncharacterized protein L484_010037 [Morus notabi... 56 5e-06 ref|XP_004296952.1| PREDICTED: uncharacterized protein At5g19025... 56 5e-06 ref|XP_007225836.1| hypothetical protein PRUPE_ppa011602mg [Prun... 56 5e-06 gb|EPS68586.1| hypothetical protein M569_06183, partial [Genlise... 56 6e-06 ref|XP_007034588.1| Ribosomal protein L34e superfamily protein i... 56 6e-06 ref|NP_001190335.1| ribosomal protein L34e superfamily protein [... 55 8e-06 >ref|XP_002277551.2| PREDICTED: uncharacterized protein At5g19025 [Vitis vinifera] Length = 216 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGED 245 RARCGCPIAKLE WGPKRGRRHKKAL++L L+GGG++ Sbjct: 179 RARCGCPIAKLEGWGPKRGRRHKKALASLALNGGGDN 215 >emb|CBI26176.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGED 245 RARCGCPIAKLE WGPKRGRRHKKAL++L L+GGG++ Sbjct: 247 RARCGCPIAKLEGWGPKRGRRHKKALASLALNGGGDN 283 >ref|XP_002516787.1| 60S ribosomal protein L34, putative [Ricinus communis] gi|223543875|gb|EEF45401.1| 60S ribosomal protein L34, putative [Ricinus communis] Length = 238 Score = 69.7 bits (169), Expect = 4e-10 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGE 248 RARCGCP+AKLE WGPK+GRRHKKAL+N+ ++GGG+ Sbjct: 201 RARCGCPVAKLEGWGPKKGRRHKKALANVAVNGGGD 236 >ref|XP_006489287.1| PREDICTED: uncharacterized protein At5g19025-like isoform X1 [Citrus sinensis] gi|568872257|ref|XP_006489288.1| PREDICTED: uncharacterized protein At5g19025-like isoform X2 [Citrus sinensis] Length = 208 Score = 68.2 bits (165), Expect = 1e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGE 248 RA+CGCP+AKL+ WGPKRGR+HKKAL+N+V +GGG+ Sbjct: 171 RAKCGCPVAKLQGWGPKRGRKHKKALANVVANGGGD 206 >ref|XP_006419801.1| hypothetical protein CICLE_v10005941mg [Citrus clementina] gi|557521674|gb|ESR33041.1| hypothetical protein CICLE_v10005941mg [Citrus clementina] Length = 198 Score = 68.2 bits (165), Expect = 1e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGE 248 RA+CGCP+AKL+ WGPKRGR+HKKAL+N+V +GGG+ Sbjct: 161 RAKCGCPVAKLQGWGPKRGRKHKKALANVVANGGGD 196 >ref|XP_004169520.1| PREDICTED: uncharacterized protein At5g19025-like isoform 3 [Cucumis sativus] Length = 224 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGEDHH 239 RARCGCPIAKLE WG KRGRRHKKAL+ L L+ GG DHH Sbjct: 187 RARCGCPIAKLEGWGTKRGRRHKKALATLGLN-GGRDHH 224 >ref|XP_004296951.1| PREDICTED: uncharacterized protein At5g19025-like isoform 1 [Fragaria vesca subsp. vesca] Length = 230 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGG 254 RARCGCP+AKLE WGPKRGRRHKKAL++ + +GG Sbjct: 194 RARCGCPVAKLEGWGPKRGRRHKKALASTIPNGG 227 >ref|NP_187269.1| ribosomal protein L34e superfamily protein [Arabidopsis thaliana] gi|6862922|gb|AAF30311.1|AC018907_11 unknown protein [Arabidopsis thaliana] gi|62867643|gb|AAY17425.1| At3g06180 [Arabidopsis thaliana] gi|90962960|gb|ABE02404.1| At3g06180 [Arabidopsis thaliana] gi|332640836|gb|AEE74357.1| ribosomal protein L34e superfamily protein [Arabidopsis thaliana] Length = 241 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGG 254 R+RCGCP+AKLE WGPKRGRRHKK+ +NL L GG Sbjct: 204 RSRCGCPVAKLEGWGPKRGRRHKKSQANLALKGG 237 >ref|XP_004150326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial-like [Cucumis sativus] Length = 874 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGG 254 RARCGCPIAKLE WG KRGRRHKKAL+ L L+GG Sbjct: 187 RARCGCPIAKLEGWGTKRGRRHKKALATLGLNGG 220 >ref|XP_002882453.1| hypothetical protein ARALYDRAFT_896728 [Arabidopsis lyrata subsp. lyrata] gi|297328293|gb|EFH58712.1| hypothetical protein ARALYDRAFT_896728 [Arabidopsis lyrata subsp. lyrata] Length = 219 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGG 254 R+RCGCP+AKL+ WGPKRGRRHKK+ +NL L GG Sbjct: 182 RSRCGCPVAKLQGWGPKRGRRHKKSQANLALKGG 215 >ref|XP_002314419.2| hypothetical protein POPTR_0010s03100g [Populus trichocarpa] gi|118487882|gb|ABK95763.1| unknown [Populus trichocarpa] gi|550328994|gb|EEF00590.2| hypothetical protein POPTR_0010s03100g [Populus trichocarpa] Length = 229 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGEDH 242 R++CGCP+AKLE WGPKRGRRHK+AL+++ +GG DH Sbjct: 193 RSKCGCPVAKLEGWGPKRGRRHKRALASVAANGG--DH 228 >ref|XP_007034587.1| Ribosomal protein L34e superfamily protein isoform 1 [Theobroma cacao] gi|508713616|gb|EOY05513.1| Ribosomal protein L34e superfamily protein isoform 1 [Theobroma cacao] Length = 233 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDG 257 RARCGCPIA+LE WGPKRGRRHKKAL+++ +G Sbjct: 198 RARCGCPIARLEGWGPKRGRRHKKALASVAQNG 230 >emb|CAN71157.1| hypothetical protein VITISV_036761 [Vitis vinifera] Length = 371 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKK 284 RARCGCPIAKLE WGPKRGRRHKK Sbjct: 179 RARCGCPIAKLEGWGPKRGRRHKK 202 >gb|EXB95838.1| Uncharacterized protein L484_010037 [Morus notabilis] Length = 218 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKK 284 RARCGCP+AKLE WGPKRGRRHKK Sbjct: 195 RARCGCPVAKLEGWGPKRGRRHKK 218 >ref|XP_004296952.1| PREDICTED: uncharacterized protein At5g19025-like isoform 2 [Fragaria vesca subsp. vesca] Length = 223 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKK 284 RARCGCP+AKLE WGPKRGRRHKK Sbjct: 194 RARCGCPVAKLEGWGPKRGRRHKK 217 >ref|XP_007225836.1| hypothetical protein PRUPE_ppa011602mg [Prunus persica] gi|462422772|gb|EMJ27035.1| hypothetical protein PRUPE_ppa011602mg [Prunus persica] Length = 204 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKK 284 RARCGCP+AKLE WGPKRGRRHKK Sbjct: 181 RARCGCPVAKLEGWGPKRGRRHKK 204 >gb|EPS68586.1| hypothetical protein M569_06183, partial [Genlisea aurea] Length = 202 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDGGGEDH 242 R +CGCP+AKLE W PKR RRHKK +LVL GG DH Sbjct: 165 RNKCGCPVAKLEGWAPKRSRRHKK---SLVLTHGGGDH 199 >ref|XP_007034588.1| Ribosomal protein L34e superfamily protein isoform 2 [Theobroma cacao] gi|508713617|gb|EOY05514.1| Ribosomal protein L34e superfamily protein isoform 2 [Theobroma cacao] Length = 225 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKA 281 RARCGCPIA+LE WGPKRGRRHKK+ Sbjct: 198 RARCGCPIARLEGWGPKRGRRHKKS 222 >ref|NP_001190335.1| ribosomal protein L34e superfamily protein [Arabidopsis thaliana] gi|334302872|sp|P0C8Q9.3|Y5902_ARATH RecName: Full=Uncharacterized protein At5g19025 gi|332005258|gb|AED92641.1| ribosomal protein L34e superfamily protein [Arabidopsis thaliana] Length = 259 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 355 RARCGCPIAKLEAWGPKRGRRHKKALSNLVLDG 257 R++CGCPIAKLE WGPKR RRHKK+ + L + G Sbjct: 222 RSKCGCPIAKLEGWGPKRSRRHKKSPAKLAVKG 254