BLASTX nr result
ID: Papaver27_contig00047263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00047263 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846006.1| hypothetical protein AMTR_s00155p00064070 [A... 55 8e-06 >ref|XP_006846006.1| hypothetical protein AMTR_s00155p00064070 [Amborella trichopoda] gi|548848762|gb|ERN07681.1| hypothetical protein AMTR_s00155p00064070 [Amborella trichopoda] Length = 323 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 86 FSSANIGAFICLKCCGVHRTLGTYISKVALMDL 184 ++SANIG FICLKCCGVHR+LGT+ISKV + L Sbjct: 41 WASANIGVFICLKCCGVHRSLGTHISKVLSVSL 73