BLASTX nr result
ID: Papaver27_contig00046917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046917 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007020841.1| Uncharacterized protein TCM_030890 [Theobrom... 71 1e-10 ref|XP_007029557.1| Uncharacterized protein TCM_025447 [Theobrom... 70 4e-10 ref|XP_007020843.1| Uncharacterized protein TCM_030892 [Theobrom... 64 3e-08 ref|XP_002318771.1| hypothetical protein POPTR_0012s10860g [Popu... 59 9e-07 ref|XP_007020844.1| Uncharacterized protein TCM_030893 [Theobrom... 58 1e-06 ref|XP_002532555.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_007020841.1| Uncharacterized protein TCM_030890 [Theobroma cacao] gi|508720469|gb|EOY12366.1| Uncharacterized protein TCM_030890 [Theobroma cacao] Length = 542 Score = 71.2 bits (173), Expect = 1e-10 Identities = 47/156 (30%), Positives = 71/156 (45%), Gaps = 2/156 (1%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENT--NACCSAAELDLSKGCLYYTLLKDKSLYMFDVE 310 RLDFS M W +V S D+ F+ + C A E + G +YYT+ D+ LY F++E Sbjct: 266 RLDFSTMEWSQVRSAKDRAFFISNFSVYAISCPANESGIEGGFVYYTVGTDRCLYSFNIE 325 Query: 309 DKCITTILPCSKLPTPWFSSEWIMMPLTVSVADGGRIMESMSSKVRQEDYTIKSKEMEDI 130 DK I+ LP LP W + W+M L + M + + Q Y + D Sbjct: 326 DKSISVSLPWVNLPKSWSTPFWVMPDLREYMHLFIEPSARMLACLLQISYDFIDSPLFDS 385 Query: 129 ISEDDCEALRKKQKVENLEEPRPWMVINEDIVESII 22 +D + L + + N +P+P +I E II Sbjct: 386 PKPEDNQILGNSRTLHNFMDPKPGGRYLMNIPEPII 421 >ref|XP_007029557.1| Uncharacterized protein TCM_025447 [Theobroma cacao] gi|508718162|gb|EOY10059.1| Uncharacterized protein TCM_025447 [Theobroma cacao] Length = 314 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/83 (37%), Positives = 48/83 (57%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENTNACCSAAELDLSKGCLYYTLLKDKSLYMFDVEDK 304 + DF WVEV S+GD +FL ++ C +++ +YYT +DK+LY++D+ED+ Sbjct: 226 KFDFCGREWVEVKSIGDNAIFLTDDFYGTCYPVVDSITRNSIYYTYSEDKNLYVYDLEDQ 285 Query: 303 CITTILPCSKLPTPWFSSEWIMM 235 ITT LPC + P W M+ Sbjct: 286 SITTHLPCPIVSRPCSLHYWCML 308 >ref|XP_007020843.1| Uncharacterized protein TCM_030892 [Theobroma cacao] gi|508720471|gb|EOY12368.1| Uncharacterized protein TCM_030892 [Theobroma cacao] Length = 741 Score = 63.5 bits (153), Expect = 3e-08 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 3/135 (2%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENT--NACCSAAELDLSKGCLY-YTLLKDKSLYMFDV 313 RL+FS M W +V S + FL C + L G +Y +T+ D+ LY F++ Sbjct: 253 RLNFSTMEWSQVRSAKGRAFFLCRTAVYAISCPTNDSGLEGGFVYIFTVGSDRCLYSFNI 312 Query: 312 EDKCITTILPCSKLPTPWFSSEWIMMPLTVSVADGGRIMESMSSKVRQEDYTIKSKEMED 133 EDK I+ LP LP W + W+M L+ S+ S + E + I SKE++ Sbjct: 313 EDKSISVSLPWENLPKSWDTPFWVMPDLS-----------SLFSNRKPEGFQILSKEVKP 361 Query: 132 IISEDDCEALRKKQK 88 E++ E +K K Sbjct: 362 EEEEEEIETEERKGK 376 >ref|XP_002318771.1| hypothetical protein POPTR_0012s10860g [Populus trichocarpa] gi|222859444|gb|EEE96991.1| hypothetical protein POPTR_0012s10860g [Populus trichocarpa] Length = 329 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/84 (28%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENTNA--CCSAAELDLSKGCLYYTLLKDKSLYMFDVE 310 +LDF++ W+ + +L D+ +F+G + CS E + +Y TL +D++LY++D++ Sbjct: 240 KLDFNERVWIRIKNLKDQAIFIGSSGAQVLACSTKESRIQGNRIYLTLPEDRTLYVYDLD 299 Query: 309 DKCITTILPCSKLPTPWFSSEWIM 238 + LPC + W ++WI+ Sbjct: 300 LCGLEVCLPCPNVKADWIQNDWIL 323 >ref|XP_007020844.1| Uncharacterized protein TCM_030893 [Theobroma cacao] gi|508720472|gb|EOY12369.1| Uncharacterized protein TCM_030893 [Theobroma cacao] Length = 729 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 2/84 (2%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENT--NACCSAAELDLSKGCLYYTLLKDKSLYMFDVE 310 RLDF M W +V S D+ F + C E + G +++T+ D+ LY F++E Sbjct: 250 RLDFRTMEWSQVRSAKDRGFFFSKTAVYAISCPVNESGIEGGFVHFTVGTDRCLYSFNIE 309 Query: 309 DKCITTILPCSKLPTPWFSSEWIM 238 DK I+ LP LP W + W+M Sbjct: 310 DKSISVSLPWVHLPKSWSTPFWVM 333 >ref|XP_002532555.1| conserved hypothetical protein [Ricinus communis] gi|223527710|gb|EEF29816.1| conserved hypothetical protein [Ricinus communis] Length = 690 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/85 (35%), Positives = 49/85 (57%) Frame = -1 Query: 483 RLDFSKMSWVEVNSLGDKVLFLGENTNACCSAAELDLSKGCLYYTLLKDKSLYMFDVEDK 304 ++DFS+M+W +V + D VLFL ++ + C ++ LY+ +LKD LY + +ED+ Sbjct: 241 KIDFSRMAWEKVECVKDSVLFLDDHYSISCPEIRPEIQGNRLYF-VLKDHKLYSYSIEDR 299 Query: 303 CITTILPCSKLPTPWFSSEWIMMPL 229 I+ + P LP F S W+M L Sbjct: 300 SISLVSP--YLPEDPFLSFWVMPDL 322