BLASTX nr result
ID: Papaver27_contig00046913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046913 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158060.1| PREDICTED: katanin p80 WD40 repeat-containin... 70 2e-10 ref|XP_004146637.1| PREDICTED: katanin p80 WD40 repeat-containin... 70 2e-10 ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phas... 65 1e-08 ref|XP_006583803.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 2e-08 ref|XP_003593480.1| Katanin p80 WD40-containing subunit B1 [Medi... 64 2e-08 ref|XP_003543076.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 2e-08 ref|XP_006597408.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 3e-08 ref|XP_003545861.1| PREDICTED: katanin p80 WD40 repeat-containin... 64 3e-08 ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Popu... 63 4e-08 ref|XP_002264711.2| PREDICTED: katanin p80 WD40 repeat-containin... 63 4e-08 ref|XP_004293499.1| PREDICTED: katanin p80 WD40 repeat-containin... 63 5e-08 gb|EYU27954.1| hypothetical protein MIMGU_mgv1a001351mg [Mimulus... 62 6e-08 ref|XP_006594334.1| PREDICTED: katanin p80 WD40 repeat-containin... 62 6e-08 ref|XP_003541552.1| PREDICTED: katanin p80 WD40 repeat-containin... 62 6e-08 ref|XP_004496305.1| PREDICTED: katanin p80 WD40 repeat-containin... 62 8e-08 emb|CBI35743.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus commu... 62 8e-08 ref|XP_006306661.1| hypothetical protein CARUB_v10008176mg [Caps... 61 1e-07 ref|XP_006467863.1| PREDICTED: katanin p80 WD40 repeat-containin... 60 2e-07 ref|XP_006467862.1| PREDICTED: katanin p80 WD40 repeat-containin... 60 2e-07 >ref|XP_004158060.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Length = 906 Score = 70.5 bits (171), Expect = 2e-10 Identities = 39/84 (46%), Positives = 52/84 (61%), Gaps = 3/84 (3%) Frame = +2 Query: 230 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 400 S EA R + S LI + + + + E + R+++ N+ DVI+ +MQ+HD Sbjct: 689 SNYEAKTRNNYEAKSTLISSHVPETDKTDNLQKGEPQISGRDSTSANDRDVIEDLMQSHD 748 Query: 401 VFLSDLRSRLTKLQVVRHFWLRND 472 VFLS LRSRLTKLQVVRHFW RND Sbjct: 749 VFLSTLRSRLTKLQVVRHFWERND 772 >ref|XP_004146637.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Length = 922 Score = 70.5 bits (171), Expect = 2e-10 Identities = 39/84 (46%), Positives = 52/84 (61%), Gaps = 3/84 (3%) Frame = +2 Query: 230 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 400 S EA R + S LI + + + + E + R+++ N+ DVI+ +MQ+HD Sbjct: 705 SNYEAKTRNNYEAKSTLISSHVPETDKTDNLQKGEPQISGRDSTSANDRDVIEDLMQSHD 764 Query: 401 VFLSDLRSRLTKLQVVRHFWLRND 472 VFLS LRSRLTKLQVVRHFW RND Sbjct: 765 VFLSTLRSRLTKLQVVRHFWERND 788 >ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] gi|561021439|gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] Length = 828 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 344 EASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +++ N E +I+G+MQ HDV LS+LRSRLTKLQVVRHFW RND Sbjct: 652 DSNSANEEKIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWERND 694 >ref|XP_006583803.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 726 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 R+++ N+ ++I+G+MQ HDV LS+LRSRLTKLQVVRHFW +ND Sbjct: 549 RDSNSANDGEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWEQND 592 >ref|XP_003593480.1| Katanin p80 WD40-containing subunit B1 [Medicago truncatula] gi|355482528|gb|AES63731.1| Katanin p80 WD40-containing subunit B1 [Medicago truncatula] Length = 1131 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +2 Query: 338 EREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +R++S N +I+G+M+ HDV LS+LRSRLTKLQVVRHFW RND Sbjct: 953 QRDSSSPNEMAIIEGLMETHDVTLSNLRSRLTKLQVVRHFWERND 997 >ref|XP_003543076.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Glycine max] Length = 824 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +2 Query: 338 EREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 + +++ N E +I+G+MQ HD LS+LRSRLTKLQVVRHFW RND Sbjct: 646 KEDSNSANEEKIIEGLMQTHDATLSNLRSRLTKLQVVRHFWERND 690 >ref|XP_006597408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Glycine max] Length = 706 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 329 IEKEREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 I KE +++ N E++I+G+MQ HDV LS+LRSRLTKLQVVRHFW ND Sbjct: 526 ISKE-DSNPANEEEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWECND 572 >ref|XP_003545861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Glycine max] Length = 825 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 329 IEKEREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 I KE +++ N E++I+G+MQ HDV LS+LRSRLTKLQVVRHFW ND Sbjct: 645 ISKE-DSNPANEEEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWECND 691 >ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] gi|550327580|gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa] Length = 990 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 R+++ N +DVI+ +MQ+HDVFL+ L+SRLTKLQV+RHFW R+D Sbjct: 813 RDSTSANYKDVIEDLMQSHDVFLNTLKSRLTKLQVIRHFWERSD 856 >ref|XP_002264711.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1 [Vitis vinifera] Length = 220 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 RE++ + E+ I+ ++QNHD+F+S LRSRLTKLQVVRHFW +ND Sbjct: 43 RESTAASEENTIEDVIQNHDLFISTLRSRLTKLQVVRHFWEQND 86 >ref|XP_004293499.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Fragaria vesca subsp. vesca] Length = 803 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/64 (51%), Positives = 41/64 (64%) Frame = +2 Query: 281 IEKKREASKERETSRSIEKEREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFW 460 IE ++ + +RE I +S +N D + +MQ HD FLS LRSRLTKLQVVRHFW Sbjct: 608 IEMEKTFTVQREEEPQISGRHMSSAKN--DPTEDLMQTHDAFLSTLRSRLTKLQVVRHFW 665 Query: 461 LRND 472 RND Sbjct: 666 ERND 669 >gb|EYU27954.1| hypothetical protein MIMGU_mgv1a001351mg [Mimulus guttatus] Length = 835 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/81 (41%), Positives = 52/81 (64%) Frame = +2 Query: 230 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKEREASRRNNEDVIDGIMQNHDVFL 409 S++++ K+Q ++++K S + I KE+ S ++++VI+ ++Q HDV L Sbjct: 625 SDQQSVMTKKDQSTYVIVKEK---SSTLDDDNVIVKEKP-STLDDDNVIENLLQGHDVLL 680 Query: 410 SDLRSRLTKLQVVRHFWLRND 472 S RSRLTKLQVVRHFW RND Sbjct: 681 STFRSRLTKLQVVRHFWERND 701 >ref|XP_006594334.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Glycine max] Length = 778 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +2 Query: 344 EASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +++ N+ ++I+G+MQ HDV LS+LRSRLTKLQVV+HFW RND Sbjct: 602 DSNSANDGEIIEGLMQTHDVTLSNLRSRLTKLQVVQHFWERND 644 >ref|XP_003541552.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Glycine max] Length = 814 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +2 Query: 344 EASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +++ N+ ++I+G+MQ HDV LS+LRSRLTKLQVV+HFW RND Sbjct: 638 DSNSANDGEIIEGLMQTHDVTLSNLRSRLTKLQVVQHFWERND 680 >ref|XP_004496305.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cicer arietinum] Length = 90 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +2 Query: 338 EREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +++++ N ++I+G+MQ HDV LS LRSRLTKLQVVRHFW R+D Sbjct: 27 QKDSNSPNEMEIIEGLMQTHDVTLSTLRSRLTKLQVVRHFWERSD 71 >emb|CBI35743.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 RE++ + E+ I ++QNHD+F+S LRSRLTKLQVVRHFW +ND Sbjct: 137 RESTAASEENTIKDVIQNHDLFISTLRSRLTKLQVVRHFWEQND 180 >ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus communis] gi|223539311|gb|EEF40902.1| katanin P80 subunit, putative [Ricinus communis] Length = 936 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/60 (51%), Positives = 43/60 (71%), Gaps = 5/60 (8%) Frame = +2 Query: 308 ERETSRSIEKE-----REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +R T ++++E R+++ N DV + +MQ HDVFLS ++SRLTKLQVVRHFW RND Sbjct: 743 DRRTLPAMKEEPQISGRDSNSSNYRDVSEELMQAHDVFLSTIKSRLTKLQVVRHFWERND 802 >ref|XP_006306661.1| hypothetical protein CARUB_v10008176mg [Capsella rubella] gi|482575372|gb|EOA39559.1| hypothetical protein CARUB_v10008176mg [Capsella rubella] Length = 1024 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 9/94 (9%) Frame = +2 Query: 218 SHIESEREASRRMK-------EQEASRLIEKKREASKERETSRSIEKERE--ASRRNNED 370 SHI S S +Q A +++ A ++ +KE + R N+ + Sbjct: 797 SHIASRHRVSPTQMLATPTVIDQMADMALDETHVAQIQQACDNLPQKEEPEISGRENDSE 856 Query: 371 VIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 +ID +MQ+HD FLS L+SRL KLQ+VRHFW R+D Sbjct: 857 IIDTLMQSHDEFLSTLQSRLAKLQIVRHFWERSD 890 >ref|XP_006467863.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Citrus sinensis] Length = 955 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 R+ + N + ++ +M+ HD+F+S LRSRLTKLQVVRHFW RND Sbjct: 778 RDTTVANEGEAVESLMETHDIFISTLRSRLTKLQVVRHFWERND 821 >ref|XP_006467862.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Citrus sinensis] Length = 983 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 341 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRND 472 R+ + N + ++ +M+ HD+F+S LRSRLTKLQVVRHFW RND Sbjct: 806 RDTTVANEGEAVESLMETHDIFISTLRSRLTKLQVVRHFWERND 849