BLASTX nr result
ID: Papaver27_contig00046788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046788 (617 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prun... 107 3e-21 ref|XP_007025730.1| Pentatricopeptide repeat-containing protein,... 107 4e-21 ref|XP_007025729.1| Pentatricopeptide repeat-containing protein,... 107 4e-21 emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] 106 6e-21 ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_007141631.1| hypothetical protein PHAVU_008G212400g [Phas... 100 4e-19 ref|XP_004249853.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 gb|EXB36727.1| hypothetical protein L484_016979 [Morus notabilis] 100 6e-19 ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 ref|XP_007014923.1| Pentatricopeptide repeat-containing protein,... 99 8e-19 ref|XP_002514778.1| pentatricopeptide repeat-containing protein,... 99 8e-19 ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 emb|CDH30703.1| putative pentatricopeptide repeat-containing pro... 97 3e-18 ref|XP_004502080.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 ref|XP_006472252.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_006472251.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] 96 6e-18 gb|ACI14439.1| Os01g67210-like protein [Aegilops speltoides] 96 6e-18 ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 96 8e-18 >ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] gi|462400651|gb|EMJ06208.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] Length = 560 Score = 107 bits (267), Expect = 3e-21 Identities = 53/90 (58%), Positives = 70/90 (77%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LEE DK L LL EMK+SG+ + ++Y +I+SLCL LDW TAEKLLEEMK+NG+ Sbjct: 471 RGYCKLEEFDKGLKLLREMKDSGVQPNVDEYNKLIQSLCLKALDWETAEKLLEEMKDNGL 530 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L+G ++GLIKAVKEL++E K E++ A Sbjct: 531 HLNGITRGLIKAVKELKEE--KIETENVVA 558 >ref|XP_007025730.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|508781096|gb|EOY28352.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] Length = 472 Score = 107 bits (266), Expect = 4e-21 Identities = 51/80 (63%), Positives = 65/80 (81%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLL+EMKENG+ Sbjct: 382 RGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENGL 441 Query: 435 SLSGNSQGLIKAVKELQKEE 376 L+G +QGLIKAVKEL+ EE Sbjct: 442 YLNGITQGLIKAVKELEAEE 461 >ref|XP_007025729.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508781095|gb|EOY28351.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 569 Score = 107 bits (266), Expect = 4e-21 Identities = 51/80 (63%), Positives = 65/80 (81%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLL+EMKENG+ Sbjct: 479 RGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENGL 538 Query: 435 SLSGNSQGLIKAVKELQKEE 376 L+G +QGLIKAVKEL+ EE Sbjct: 539 YLNGITQGLIKAVKELEAEE 558 >emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] Length = 549 Score = 106 bits (264), Expect = 6e-21 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ DKA+ LL EMKE G+ + ++Y +I+SLCL LDW TAEKLLEEMK+NG+ Sbjct: 460 RGYCKLEQFDKAVELLGEMKEHGVQPNTDEYNKLIQSLCLKALDWQTAEKLLEEMKQNGL 519 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQE 358 L+G ++GLI+AVKEL+ EE +A +E Sbjct: 520 HLNGITRGLIRAVKELE-EEGRATEE 544 >ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Solanum tuberosum] Length = 595 Score = 105 bits (261), Expect = 1e-20 Identities = 49/80 (61%), Positives = 64/80 (80%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ DKAL LL EMKE G+ + ++Y I+SLCL LDW TAEKLLEEMKENG+ Sbjct: 506 RGYCKLEQYDKALELLGEMKEYGVQPNADEYNKFIQSLCLKALDWTTAEKLLEEMKENGV 565 Query: 435 SLSGNSQGLIKAVKELQKEE 376 L+ ++GL++AVKEL++EE Sbjct: 566 HLNAITKGLVRAVKELEQEE 585 >ref|XP_007141631.1| hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] gi|561014764|gb|ESW13625.1| hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] Length = 535 Score = 100 bits (248), Expect = 4e-19 Identities = 50/90 (55%), Positives = 67/90 (74%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ D+AL L +EMK G+ ++Y+ +I+SLCL LDW AEKLLEEMKENG+ Sbjct: 444 RGYCKLEQFDEALKLFSEMKNYGVQPSVDEYEKLIQSLCLKALDWEMAEKLLEEMKENGL 503 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L G ++GLI+AVKE++KE + ESI A Sbjct: 504 HLKGITRGLIRAVKEMEKEVVEV--ESITA 531 >ref|XP_004249853.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Solanum lycopersicum] Length = 589 Score = 100 bits (248), Expect = 4e-19 Identities = 48/80 (60%), Positives = 63/80 (78%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGY +LE+ DKAL LL +MKE G+ + ++Y I+SLCL LDW TAEKLLEEMKENG+ Sbjct: 500 RGYFKLEQYDKALELLGDMKEYGVQPNADEYNKFIQSLCLKALDWTTAEKLLEEMKENGV 559 Query: 435 SLSGNSQGLIKAVKELQKEE 376 L+ ++GLI+AVKEL++EE Sbjct: 560 HLNAITKGLIRAVKELEQEE 579 >gb|EXB36727.1| hypothetical protein L484_016979 [Morus notabilis] Length = 555 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/90 (52%), Positives = 68/90 (75%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LEE DKAL LL EM++ G+ + ++Y +I+SLCL LDW TAEKLL+EM E G+ Sbjct: 466 RGYCKLEEFDKALELLAEMEDHGVKPNVDEYNKLIQSLCLKALDWETAEKLLDEMNEKGL 525 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L+G ++GLI+AVKE+ +EE + + ++ A Sbjct: 526 HLNGITRGLIRAVKEMVEEEVETTKINVEA 555 >ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] gi|449477884|ref|XP_004155152.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] Length = 479 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/89 (52%), Positives = 67/89 (75%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 R +C+LEE D AL LL+EMK G+ + ++Y +IRSLCL +DW T+E+L EEMKENG+ Sbjct: 390 RNHCKLEEYDSALKLLSEMKNFGVQPNVDEYNKLIRSLCLKAVDWRTSERLFEEMKENGL 449 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIA 349 L+G ++GLI+AV+EL++EE + SIA Sbjct: 450 HLNGITRGLIRAVRELEEEELTTEELSIA 478 >ref|XP_007014923.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508785286|gb|EOY32542.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 371 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/80 (60%), Positives = 61/80 (76%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE DKAL LL EMK+ + + ++Y +I+SLCL LDW EKLL+EMKENG+ Sbjct: 281 RGYCKIEEFDKALKLLAEMKDFEVQPNVDEYNKLIQSLCLKALDWQIVEKLLDEMKENGL 340 Query: 435 SLSGNSQGLIKAVKELQKEE 376 L+G QGLIKAVKEL+ EE Sbjct: 341 YLNGIMQGLIKAVKELEAEE 360 >ref|XP_002514778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545829|gb|EEF47332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/79 (59%), Positives = 64/79 (81%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ DKAL+LL EMK G+ A+ ++Y +I+SLCL LDW AEKLLE+MKE+G+ Sbjct: 496 RGYCKLEQFDKALDLLAEMKTFGVQANADEYNKLIQSLCLKALDWERAEKLLEKMKEDGL 555 Query: 435 SLSGNSQGLIKAVKELQKE 379 L+G ++GLI+AVKEL+ E Sbjct: 556 HLNGITRGLIRAVKELEDE 574 >ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 1 [Brachypodium distachyon] gi|357126326|ref|XP_003564839.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 2 [Brachypodium distachyon] Length = 552 Score = 98.6 bits (244), Expect = 1e-18 Identities = 48/88 (54%), Positives = 66/88 (75%), Gaps = 1/88 (1%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE +KAL LNEMKE G+ + ++Y +I+SLCL +DW TAEKLLEEM+ +G+ Sbjct: 465 RGYCKMEEFEKALECLNEMKEDGLQPNMDEYNKLIQSLCLKAMDWRTAEKLLEEMESSGL 524 Query: 435 SLSGNSQGLIKAVKELQKEE-SKAPQES 355 L G ++ L+ AVKEL+ EE SK QE+ Sbjct: 525 CLKGITRSLVAAVKELEMEEMSKDSQEA 552 >ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Glycine max] Length = 539 Score = 97.8 bits (242), Expect = 2e-18 Identities = 50/90 (55%), Positives = 67/90 (74%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ D+AL LL EMK+ G+ ++Y +I+SLCL LDW AEKL EEMKE+G+ Sbjct: 450 RGYCKLEQFDEALKLLAEMKDYGVRPSVDEYDKLIQSLCLKALDWKMAEKLQEEMKESGL 509 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L G ++GLI+AVKE++KE +A ESI A Sbjct: 510 HLKGITRGLIRAVKEMEKEVVEA--ESITA 537 >emb|CDH30703.1| putative pentatricopeptide repeat-containing protein [Cajanus cajan] Length = 534 Score = 97.4 bits (241), Expect = 3e-18 Identities = 51/90 (56%), Positives = 66/90 (73%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE+ D+AL LL EMK+ G+ ++Y +I+SLCL LDW AEKL EEMKENG+ Sbjct: 445 RGYCKLEQFDEALKLLAEMKDFGVRPSVDEYDKLIQSLCLKGLDWERAEKLHEEMKENGL 504 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L G ++GLI+AVKEL+ E +A ESI A Sbjct: 505 LLKGITRGLIRAVKELENEAVEA--ESITA 532 >ref|XP_004502080.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cicer arietinum] Length = 581 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/90 (51%), Positives = 65/90 (72%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LE D+AL LL EMK+ G+ A ++Y+ +I+SLCL LDW AEKL +EMKENG+ Sbjct: 492 RGYCKLERFDEALELLAEMKDFGVRATADEYEKLIQSLCLKALDWERAEKLQQEMKENGL 551 Query: 435 SLSGNSQGLIKAVKELQKEESKAPQESIAA 346 L G ++ L++AVKE + E +A +S+ A Sbjct: 552 HLKGITRALVRAVKETEMEAVEAQSDSLVA 581 >ref|XP_006472252.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform X2 [Citrus sinensis] Length = 489 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/79 (56%), Positives = 62/79 (78%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LEE D AL LLNEMK+ G+ + ++Y +I+SLCL LDW TAEKLLE+MK G+ Sbjct: 400 RGYCKLEEFDNALKLLNEMKDVGVQPNVDEYNKLIQSLCLKALDWRTAEKLLEDMKLKGL 459 Query: 435 SLSGNSQGLIKAVKELQKE 379 L+G ++ LI+AVKEL+++ Sbjct: 460 HLNGITRALIRAVKELEED 478 >ref|XP_006472251.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform X1 [Citrus sinensis] Length = 570 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/79 (56%), Positives = 62/79 (78%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC+LEE D AL LLNEMK+ G+ + ++Y +I+SLCL LDW TAEKLLE+MK G+ Sbjct: 481 RGYCKLEEFDNALKLLNEMKDVGVQPNVDEYNKLIQSLCLKALDWRTAEKLLEDMKLKGL 540 Query: 435 SLSGNSQGLIKAVKELQKE 379 L+G ++ LI+AVKEL+++ Sbjct: 541 HLNGITRALIRAVKELEED 559 >gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] Length = 565 Score = 96.3 bits (238), Expect = 6e-18 Identities = 48/88 (54%), Positives = 66/88 (75%), Gaps = 1/88 (1%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE +KAL L EMKE G+ + ++Y ++I+SLCL ++DW TAEKLLEEM+ +G+ Sbjct: 478 RGYCKMEEFEKALECLKEMKEDGLQPNMDEYSELIQSLCLKSMDWRTAEKLLEEMEGSGL 537 Query: 435 SLSGNSQGLIKAVKELQKEE-SKAPQES 355 L G + LI AVKEL+ EE SK QE+ Sbjct: 538 CLKGIIRSLIPAVKELETEEASKDSQEA 565 >gb|ACI14439.1| Os01g67210-like protein [Aegilops speltoides] Length = 358 Score = 96.3 bits (238), Expect = 6e-18 Identities = 48/88 (54%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -3 Query: 615 RGYCQLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGM 436 RGYC++EE DKAL L EMK+ G+ + ++Y +I+SLCL +DW TAEKLLEEM+ +G+ Sbjct: 271 RGYCKMEEFDKALECLKEMKQDGVQPNVDEYNKLIQSLCLKAMDWRTAEKLLEEMEGSGL 330 Query: 435 SLSGNSQGLIKAVKELQKEE-SKAPQES 355 L G ++ LI AVKEL+ EE SK QE+ Sbjct: 331 YLKGLTRSLIAAVKELEMEEASKDSQEA 358 >ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Vitis vinifera] Length = 509 Score = 95.9 bits (237), Expect = 8e-18 Identities = 47/82 (57%), Positives = 65/82 (79%) Frame = -3 Query: 603 QLEETDKALNLLNEMKESGILADENDYKDVIRSLCLNTLDWATAEKLLEEMKENGMSLSG 424 +LE+ DKA+ LL EMKE G+ + ++Y +I+SLCL LDW TAEKLLEEMK+NG+ L+G Sbjct: 424 KLEQFDKAVELLGEMKEHGVQPNTDEYNKLIQSLCLKALDWQTAEKLLEEMKQNGLHLNG 483 Query: 423 NSQGLIKAVKELQKEESKAPQE 358 ++GLI+AVKEL+ EE +A +E Sbjct: 484 ITRGLIRAVKELE-EEGRATEE 504