BLASTX nr result
ID: Papaver27_contig00046787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046787 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prun... 105 6e-21 ref|XP_007025730.1| Pentatricopeptide repeat-containing protein,... 104 1e-20 ref|XP_007025729.1| Pentatricopeptide repeat-containing protein,... 104 1e-20 emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] 101 9e-20 gb|EXB36727.1| hypothetical protein L484_016979 [Morus notabilis] 100 2e-19 ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_007141631.1| hypothetical protein PHAVU_008G212400g [Phas... 99 8e-19 ref|XP_002514778.1| pentatricopeptide repeat-containing protein,... 99 8e-19 emb|CDH30703.1| putative pentatricopeptide repeat-containing pro... 97 2e-18 gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] 97 2e-18 ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_007014923.1| Pentatricopeptide repeat-containing protein,... 97 2e-18 dbj|BAJ85493.1| predicted protein [Hordeum vulgare subsp. vulgare] 97 2e-18 ref|XP_006472252.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_006472251.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_004502080.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_003546486.1| PREDICTED: pentatricopeptide repeat-containi... 96 5e-18 gb|EAY76826.1| hypothetical protein OsI_04786 [Oryza sativa Indi... 96 5e-18 dbj|BAF36557.1| pentatricopeptide repeat protein [Oryza sativa J... 96 5e-18 >ref|XP_007205009.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] gi|462400651|gb|EMJ06208.1| hypothetical protein PRUPE_ppa003637mg [Prunus persica] Length = 560 Score = 105 bits (262), Expect = 6e-21 Identities = 51/82 (62%), Positives = 67/82 (81%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LEE DK L LL EMK+SG+ + ++Y +I+SLCL LDWETAEKLLEEMK +G+ Sbjct: 471 RGYCKLEEFDKGLKLLREMKDSGVQPNVDEYNKLIQSLCLKALDWETAEKLLEEMKDNGL 530 Query: 269 CLSGNSQGLIKAVKELQKEESE 204 L+G ++GLIKAVKEL++E+ E Sbjct: 531 HLNGITRGLIKAVKELKEEKIE 552 >ref|XP_007025730.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|508781096|gb|EOY28352.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] Length = 472 Score = 104 bits (260), Expect = 1e-20 Identities = 49/83 (59%), Positives = 67/83 (80%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW+TAEKLL+EMK +G+ Sbjct: 382 RGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENGL 441 Query: 269 CLSGNSQGLIKAVKELQKEESEA 201 L+G +QGLIKAVKEL+ EE ++ Sbjct: 442 YLNGITQGLIKAVKELEAEEVDS 464 >ref|XP_007025729.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508781095|gb|EOY28351.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 569 Score = 104 bits (260), Expect = 1e-20 Identities = 49/83 (59%), Positives = 67/83 (80%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE DKAL LL EMK+ G+ + ++Y +I+SLCL LDW+TAEKLL+EMK +G+ Sbjct: 479 RGYCKIEEFDKALKLLAEMKDFGVQPNVDEYNKLIQSLCLKALDWQTAEKLLDEMKENGL 538 Query: 269 CLSGNSQGLIKAVKELQKEESEA 201 L+G +QGLIKAVKEL+ EE ++ Sbjct: 539 YLNGITQGLIKAVKELEAEEVDS 561 >emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] Length = 549 Score = 101 bits (252), Expect = 9e-20 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ DKA+ LL EMKE G+ + ++Y +I+SLCL LDW+TAEKLLEEMK +G+ Sbjct: 460 RGYCKLEQFDKAVELLGEMKEHGVQPNTDEYNKLIQSLCLKALDWQTAEKLLEEMKQNGL 519 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQE 192 L+G ++GLI+AVKEL+ EE A +E Sbjct: 520 HLNGITRGLIRAVKELE-EEGRATEE 544 >gb|EXB36727.1| hypothetical protein L484_016979 [Morus notabilis] Length = 555 Score = 100 bits (249), Expect = 2e-19 Identities = 48/90 (53%), Positives = 68/90 (75%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LEE DKAL LL EM++ G+ + ++Y +I+SLCL LDWETAEKLL+EM G+ Sbjct: 466 RGYCKLEEFDKALELLAEMEDHGVKPNVDEYNKLIQSLCLKALDWETAEKLLDEMNEKGL 525 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L+G ++GLI+AVKE+ +EE E + ++ A Sbjct: 526 HLNGITRGLIRAVKEMVEEEVETTKINVEA 555 >ref|XP_006351118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Solanum tuberosum] Length = 595 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/80 (58%), Positives = 63/80 (78%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ DKAL LL EMKE G+ + ++Y I+SLCL LDW TAEKLLEEMK +G+ Sbjct: 506 RGYCKLEQYDKALELLGEMKEYGVQPNADEYNKFIQSLCLKALDWTTAEKLLEEMKENGV 565 Query: 269 CLSGNSQGLIKAVKELQKEE 210 L+ ++GL++AVKEL++EE Sbjct: 566 HLNAITKGLVRAVKELEQEE 585 >ref|XP_007141631.1| hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] gi|561014764|gb|ESW13625.1| hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] Length = 535 Score = 98.6 bits (244), Expect = 8e-19 Identities = 50/90 (55%), Positives = 67/90 (74%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ D+AL L +EMK G+ ++Y+ +I+SLCL LDWE AEKLLEEMK +G+ Sbjct: 444 RGYCKLEQFDEALKLFSEMKNYGVQPSVDEYEKLIQSLCLKALDWEMAEKLLEEMKENGL 503 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L G ++GLI+AVKE++KE E ESI A Sbjct: 504 HLKGITRGLIRAVKEMEKEVVEV--ESITA 531 >ref|XP_002514778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545829|gb|EEF47332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/82 (58%), Positives = 64/82 (78%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ DKAL+LL EMK G+ A+ ++Y +I+SLCL LDWE AEKLLE+MK G+ Sbjct: 496 RGYCKLEQFDKALDLLAEMKTFGVQANADEYNKLIQSLCLKALDWERAEKLLEKMKEDGL 555 Query: 269 CLSGNSQGLIKAVKELQKEESE 204 L+G ++GLI+AVKEL+ E E Sbjct: 556 HLNGITRGLIRAVKELEDEGIE 577 >emb|CDH30703.1| putative pentatricopeptide repeat-containing protein [Cajanus cajan] Length = 534 Score = 97.4 bits (241), Expect = 2e-18 Identities = 51/90 (56%), Positives = 66/90 (73%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ D+AL LL EMK+ G+ ++Y +I+SLCL LDWE AEKL EEMK +G+ Sbjct: 445 RGYCKLEQFDEALKLLAEMKDFGVRPSVDEYDKLIQSLCLKGLDWERAEKLHEEMKENGL 504 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L G ++GLI+AVKEL+ E EA ESI A Sbjct: 505 LLKGITRGLIRAVKELENEAVEA--ESITA 532 >gb|EMT14531.1| hypothetical protein F775_12470 [Aegilops tauschii] Length = 565 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/81 (55%), Positives = 62/81 (76%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE +KAL L EMKE G+ + ++Y ++I+SLCL ++DW TAEKLLEEM+ G+ Sbjct: 478 RGYCKMEEFEKALECLKEMKEDGLQPNMDEYSELIQSLCLKSMDWRTAEKLLEEMEGSGL 537 Query: 269 CLSGNSQGLIKAVKELQKEES 207 CL G + LI AVKEL+ EE+ Sbjct: 538 CLKGIIRSLIPAVKELETEEA 558 >ref|XP_003564838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 1 [Brachypodium distachyon] gi|357126326|ref|XP_003564839.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 2 [Brachypodium distachyon] Length = 552 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/88 (53%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL +DW TAEKLLEEM+ G+ Sbjct: 465 RGYCKMEEFEKALECLNEMKEDGLQPNMDEYNKLIQSLCLKAMDWRTAEKLLEEMESSGL 524 Query: 269 CLSGNSQGLIKAVKELQKEE-SEAPQES 189 CL G ++ L+ AVKEL+ EE S+ QE+ Sbjct: 525 CLKGITRSLVAAVKELEMEEMSKDSQEA 552 >ref|XP_007014923.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508785286|gb|EOY32542.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 371 Score = 97.1 bits (240), Expect = 2e-18 Identities = 46/83 (55%), Positives = 63/83 (75%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE DKAL LL EMK+ + + ++Y +I+SLCL LDW+ EKLL+EMK +G+ Sbjct: 281 RGYCKIEEFDKALKLLAEMKDFEVQPNVDEYNKLIQSLCLKALDWQIVEKLLDEMKENGL 340 Query: 269 CLSGNSQGLIKAVKELQKEESEA 201 L+G QGLIKAVKEL+ EE ++ Sbjct: 341 YLNGIMQGLIKAVKELEAEEVDS 363 >dbj|BAJ85493.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 567 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/81 (55%), Positives = 61/81 (75%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL +DW TAEKLLEEM+ G+ Sbjct: 480 RGYCKMEEFEKALECLKEMKEDGLQPNMDEYNKLIQSLCLKAMDWRTAEKLLEEMEGSGL 539 Query: 269 CLSGNSQGLIKAVKELQKEES 207 CL G ++ LI AVKEL+ EE+ Sbjct: 540 CLKGITRSLIAAVKELEMEEA 560 >ref|XP_006472252.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform X2 [Citrus sinensis] Length = 489 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/90 (51%), Positives = 66/90 (73%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LEE D AL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLLE+MK+ G+ Sbjct: 400 RGYCKLEEFDNALKLLNEMKDVGVQPNVDEYNKLIQSLCLKALDWRTAEKLLEDMKLKGL 459 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L+G ++ LI+AVKEL+++ E + + A Sbjct: 460 HLNGITRALIRAVKELEEDAIENGEALVEA 489 >ref|XP_006472251.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform X1 [Citrus sinensis] Length = 570 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/90 (51%), Positives = 66/90 (73%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LEE D AL LL EMK+ G+ + ++Y +I+SLCL LDW TAEKLLE+MK+ G+ Sbjct: 481 RGYCKLEEFDNALKLLNEMKDVGVQPNVDEYNKLIQSLCLKALDWRTAEKLLEDMKLKGL 540 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L+G ++ LI+AVKEL+++ E + + A Sbjct: 541 HLNGITRALIRAVKELEEDAIENGEALVEA 570 >ref|XP_004502080.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cicer arietinum] Length = 581 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/90 (51%), Positives = 65/90 (72%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE D+AL LL EMK+ G+ A ++Y+ +I+SLCL LDWE AEKL +EMK +G+ Sbjct: 492 RGYCKLERFDEALELLAEMKDFGVRATADEYEKLIQSLCLKALDWERAEKLQQEMKENGL 551 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L G ++ L++AVKE + E EA +S+ A Sbjct: 552 HLKGITRALVRAVKETEMEAVEAQSDSLVA 581 >ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Glycine max] Length = 539 Score = 96.3 bits (238), Expect = 4e-18 Identities = 50/90 (55%), Positives = 66/90 (73%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ D+AL LL EMK+ G+ ++Y +I+SLCL LDW+ AEKL EEMK G+ Sbjct: 450 RGYCKLEQFDEALKLLAEMKDYGVRPSVDEYDKLIQSLCLKALDWKMAEKLQEEMKESGL 509 Query: 269 CLSGNSQGLIKAVKELQKEESEAPQESIAA 180 L G ++GLI+AVKE++KE EA ESI A Sbjct: 510 HLKGITRGLIRAVKEMEKEVVEA--ESITA 537 >ref|XP_003546486.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 1 [Glycine max] Length = 538 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/83 (56%), Positives = 62/83 (74%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC+LE+ D+AL LL EMK+ G+ ++Y +I+SLCL LDWE AEKL EEMK G+ Sbjct: 449 RGYCKLEQFDEALKLLAEMKDYGVHPSVDEYDKLIQSLCLKALDWEMAEKLHEEMKESGL 508 Query: 269 CLSGNSQGLIKAVKELQKEESEA 201 L G ++GLI+AVKE++KE EA Sbjct: 509 HLKGITRGLIRAVKEMEKEVVEA 531 >gb|EAY76826.1| hypothetical protein OsI_04786 [Oryza sativa Indica Group] Length = 564 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/88 (53%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL LDW TAE LL+EM+ G+ Sbjct: 477 RGYCKMEEFEKALECLKEMKEDGMEPNMDEYNKLIQSLCLKALDWRTAENLLKEMEDGGL 536 Query: 269 CLSGNSQGLIKAVKELQKEE-SEAPQES 189 CL G ++ LI AVKEL+ +E S+A QE+ Sbjct: 537 CLKGTTRSLIAAVKELEMDELSKASQEA 564 >dbj|BAF36557.1| pentatricopeptide repeat protein [Oryza sativa Japonica Group] gi|125572970|gb|EAZ14485.1| hypothetical protein OsJ_04408 [Oryza sativa Japonica Group] Length = 564 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/88 (53%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -3 Query: 449 RGYCQLEETDKALNLLTEMKESGIVADENDYKDVIRSLCLNTLDWETAEKLLEEMKVHGM 270 RGYC++EE +KAL L EMKE G+ + ++Y +I+SLCL LDW TAE LL+EM+ G+ Sbjct: 477 RGYCKMEEFEKALECLKEMKEDGMEPNMDEYNKLIQSLCLKALDWRTAENLLKEMEDGGL 536 Query: 269 CLSGNSQGLIKAVKELQKEE-SEAPQES 189 CL G ++ LI AVKEL+ +E S+A QE+ Sbjct: 537 CLKGTTRSLIAAVKELEMDELSKASQEA 564