BLASTX nr result
ID: Papaver27_contig00046298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046298 (626 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494424.1| PREDICTED: myosin-11-like [Citrus sinensis] 57 5e-06 ref|XP_006435516.1| hypothetical protein CICLE_v10000432mg [Citr... 57 5e-06 >ref|XP_006494424.1| PREDICTED: myosin-11-like [Citrus sinensis] Length = 715 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 622 EEANALLSEIETAKSQAAKLQEAYGLEEKFANSENHLISMELIANLGSDQLSKMV 458 EEAN LL+E E A +A KL+EA EE+F N H ISMEL+ N G QL+++V Sbjct: 653 EEANLLLAEAEAAGQEAKKLEEANLKEEEFTNLPEHFISMELVTNFGRKQLAELV 707 >ref|XP_006435516.1| hypothetical protein CICLE_v10000432mg [Citrus clementina] gi|557537638|gb|ESR48756.1| hypothetical protein CICLE_v10000432mg [Citrus clementina] Length = 715 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 622 EEANALLSEIETAKSQAAKLQEAYGLEEKFANSENHLISMELIANLGSDQLSKMV 458 EEAN LL+E E A +A KL+EA EE+F N H ISMEL+ N G QL+++V Sbjct: 653 EEANLLLAEAEAAGQEAKKLEEANLKEEEFTNLPEHFISMELVTNFGRKQLAELV 707