BLASTX nr result
ID: Papaver27_contig00046041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046041 (520 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004424623.1| PREDICTED: ubiquitin-40S ribosomal protein S... 56 6e-06 >ref|XP_004424623.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Ceratotherium simum simum] Length = 155 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 5/70 (7%) Frame = -3 Query: 512 KRKIEEKETFPIQQQKFIFAGKELRD-----SFNIDKFYNEATIYLTSGLCGGSRRRGKD 348 K KI+ KE P+ QQ+ IFAGK+L D +NI K E+T++L LCGG+++R K Sbjct: 27 KAKIQNKEGIPLDQQRLIFAGKQLEDGRTLSDYNIQK---ESTLHLVLRLCGGAKKRKKS 83 Query: 347 ISKGQRNIFK 318 + ++N+ K Sbjct: 84 YTTSKKNMRK 93