BLASTX nr result
ID: Papaver27_contig00046004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00046004 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006658132.1| PREDICTED: B3 domain-containing protein Os07... 76 5e-12 ref|NP_001060642.1| Os07g0679700 [Oryza sativa Japonica Group] g... 76 5e-12 gb|EEE67824.1| hypothetical protein OsJ_25593 [Oryza sativa Japo... 76 5e-12 gb|EEC82689.1| hypothetical protein OsI_27346 [Oryza sativa Indi... 76 5e-12 ref|XP_002323669.1| hypothetical protein POPTR_0016s14350g [Popu... 75 7e-12 ref|XP_002309182.2| hypothetical protein POPTR_0006s10880g [Popu... 75 9e-12 ref|XP_004302530.1| PREDICTED: B3 domain-containing protein Os07... 75 1e-11 gb|EYU36907.1| hypothetical protein MIMGU_mgv1a001615mg [Mimulus... 74 2e-11 ref|XP_003562447.1| PREDICTED: B3 domain-containing protein Os07... 74 2e-11 ref|XP_004958700.1| PREDICTED: B3 domain-containing protein Os07... 74 3e-11 ref|XP_004958699.1| PREDICTED: B3 domain-containing protein Os07... 74 3e-11 ref|XP_002463393.1| hypothetical protein SORBIDRAFT_02g043000 [S... 74 3e-11 ref|NP_001168259.1| uncharacterized protein LOC100382023 [Zea ma... 74 3e-11 ref|XP_007017086.1| High-level expression of sugar-inducible gen... 73 4e-11 dbj|BAJ89891.1| predicted protein [Hordeum vulgare subsp. vulgare] 73 4e-11 ref|XP_002523945.1| transcription factor, putative [Ricinus comm... 73 5e-11 ref|XP_002528687.1| transcription factor, putative [Ricinus comm... 73 5e-11 gb|EXC19529.1| B3 domain-containing protein [Morus notabilis] 72 6e-11 gb|EXC23828.1| B3 domain-containing protein [Morus notabilis] 72 8e-11 dbj|BAE99977.1| predicted protein [Arabidopsis thaliana] 72 8e-11 >ref|XP_006658132.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Oryza brachyantha] Length = 953 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG AVLC CG AYEQ V+C+ FH KESGWR Sbjct: 30 EWRKGWPLRSGGYAVLCDKCGLAYEQLVFCDIFHQKESGWR 70 >ref|NP_001060642.1| Os07g0679700 [Oryza sativa Japonica Group] gi|75133539|sp|Q6Z3U3.1|Y7797_ORYSJ RecName: Full=B3 domain-containing protein Os07g0679700 gi|34394741|dbj|BAC84102.1| VP1/ABI3 family regulatory protein-like [Oryza sativa Japonica Group] gi|113612178|dbj|BAF22556.1| Os07g0679700 [Oryza sativa Japonica Group] Length = 949 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG AVLC CG AYEQ V+C+ FH KESGWR Sbjct: 33 EWRKGWPLRSGGFAVLCDKCGLAYEQLVFCDIFHQKESGWR 73 >gb|EEE67824.1| hypothetical protein OsJ_25593 [Oryza sativa Japonica Group] Length = 949 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG AVLC CG AYEQ V+C+ FH KESGWR Sbjct: 33 EWRKGWPLRSGGFAVLCDKCGLAYEQLVFCDIFHQKESGWR 73 >gb|EEC82689.1| hypothetical protein OsI_27346 [Oryza sativa Indica Group] Length = 947 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG AVLC CG AYEQ V+C+ FH KESGWR Sbjct: 33 EWRKGWPLRSGGFAVLCDKCGLAYEQLVFCDIFHQKESGWR 73 >ref|XP_002323669.1| hypothetical protein POPTR_0016s14350g [Populus trichocarpa] gi|222868299|gb|EEF05430.1| hypothetical protein POPTR_0016s14350g [Populus trichocarpa] Length = 917 Score = 75.5 bits (184), Expect = 7e-12 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 310 WRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 WRKGW LRSG A+LC NCG AYEQSV+CE FH+K+SGWR Sbjct: 24 WRKGWALRSGDFAILCDNCGSAYEQSVFCEVFHSKDSGWR 63 >ref|XP_002309182.2| hypothetical protein POPTR_0006s10880g [Populus trichocarpa] gi|550335943|gb|EEE92705.2| hypothetical protein POPTR_0006s10880g [Populus trichocarpa] Length = 880 Score = 75.1 bits (183), Expect = 9e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 310 WRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 WRKGW LRSG A+LC NCG AYEQS++CE FH+K+SGWR Sbjct: 26 WRKGWALRSGDFAILCDNCGSAYEQSIFCEVFHSKDSGWR 65 >ref|XP_004302530.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Fragaria vesca subsp. vesca] Length = 907 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW LRSG A LCH CG AYEQSV+C+ FH+KESGWR Sbjct: 18 EWKKGWALRSGRFANLCHKCGSAYEQSVFCDVFHSKESGWR 58 >gb|EYU36907.1| hypothetical protein MIMGU_mgv1a001615mg [Mimulus guttatus] Length = 785 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW L+SGG A LC+NCG AYE SV+CE FH+ ESGWR Sbjct: 18 EWKKGWILKSGGFATLCYNCGSAYENSVFCETFHSDESGWR 58 >ref|XP_003562447.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Brachypodium distachyon] Length = 943 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG AVLC CG AYEQ V+C+ FH +ESGWR Sbjct: 27 EWRKGWPLRSGGFAVLCDKCGLAYEQLVFCDIFHPQESGWR 67 >ref|XP_004958700.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X2 [Setaria italica] Length = 921 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 +WRKGW LRSGG A+LC CG AYEQ V+C+ FH KESGWR Sbjct: 30 DWRKGWPLRSGGFALLCDKCGLAYEQFVFCDIFHQKESGWR 70 >ref|XP_004958699.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X1 [Setaria italica] Length = 957 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 +WRKGW LRSGG A+LC CG AYEQ V+C+ FH KESGWR Sbjct: 30 DWRKGWPLRSGGFALLCDKCGLAYEQFVFCDIFHQKESGWR 70 >ref|XP_002463393.1| hypothetical protein SORBIDRAFT_02g043000 [Sorghum bicolor] gi|241926770|gb|EER99914.1| hypothetical protein SORBIDRAFT_02g043000 [Sorghum bicolor] Length = 957 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 +WRKGW LRSGG A+LC CG AYEQ V+C+ FH KESGWR Sbjct: 32 DWRKGWPLRSGGFALLCDKCGLAYEQFVFCDIFHQKESGWR 72 >ref|NP_001168259.1| uncharacterized protein LOC100382023 [Zea mays] gi|223947081|gb|ACN27624.1| unknown [Zea mays] gi|407232682|gb|AFT82683.1| ABI32 ABI3VP1 type transcription factor, partial [Zea mays subsp. mays] gi|414888118|tpg|DAA64132.1| TPA: hypothetical protein ZEAMMB73_607253 [Zea mays] gi|414888119|tpg|DAA64133.1| TPA: hypothetical protein ZEAMMB73_607253 [Zea mays] gi|414888120|tpg|DAA64134.1| TPA: hypothetical protein ZEAMMB73_607253 [Zea mays] Length = 963 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 +WRKGW LRSGG A+LC CG AYEQ V+C+ FH KESGWR Sbjct: 36 DWRKGWPLRSGGFALLCDKCGLAYEQFVFCDIFHQKESGWR 76 >ref|XP_007017086.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] gi|590591689|ref|XP_007017087.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] gi|508787449|gb|EOY34705.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] gi|508787450|gb|EOY34706.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] Length = 905 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW LRSGG A LC+ CG AYE SVYC+ FH +ESGWR Sbjct: 18 EWKKGWPLRSGGFAHLCYRCGSAYEDSVYCDTFHLEESGWR 58 >dbj|BAJ89891.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 980 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWRKGW LRSGG A+LC CG A+EQ V+C+ FH KESGWR Sbjct: 56 EWRKGWPLRSGGFALLCDKCGLAFEQLVFCDIFHQKESGWR 96 >ref|XP_002523945.1| transcription factor, putative [Ricinus communis] gi|223536792|gb|EEF38432.1| transcription factor, putative [Ricinus communis] Length = 861 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EWR+GW LRSGG A+LC+ CG AYE SVYC+ FH +E GWR Sbjct: 18 EWRRGWTLRSGGYALLCYTCGSAYENSVYCDTFHLEEPGWR 58 >ref|XP_002528687.1| transcription factor, putative [Ricinus communis] gi|223531859|gb|EEF33676.1| transcription factor, putative [Ricinus communis] Length = 891 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 +WRKGW LRSG A+LC NCG AYEQS +C+ FH+K+SGWR Sbjct: 18 DWRKGWPLRSGDFALLCDNCGTAYEQSTFCDLFHSKDSGWR 58 >gb|EXC19529.1| B3 domain-containing protein [Morus notabilis] Length = 892 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW LRSGG A LC+ CG AYE S+YCE FH+ E GWR Sbjct: 18 EWKKGWPLRSGGLAYLCYTCGCAYESSIYCERFHSDEPGWR 58 >gb|EXC23828.1| B3 domain-containing protein [Morus notabilis] Length = 857 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW LRSGG A LC CG AYEQSV+C+ FH+ ESGWR Sbjct: 15 EWKKGWALRSGGYANLCDKCGSAYEQSVFCDVFHSTESGWR 55 >dbj|BAE99977.1| predicted protein [Arabidopsis thaliana] Length = 776 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 307 EWRKGWDLRSGGSAVLCHNCGFAYEQSVYCEAFHTKESGWR 429 EW+KGW +RSG A LC CG AYEQS++CE FH KESGWR Sbjct: 20 EWKKGWPMRSGDLASLCDKCGCAYEQSIFCEVFHAKESGWR 60