BLASTX nr result
ID: Papaver27_contig00044303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00044303 (619 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006390960.1| hypothetical protein EUTSA_v10018099mg [Eutr... 62 2e-07 ref|XP_002888741.1| hypothetical protein ARALYDRAFT_339218 [Arab... 60 5e-07 ref|XP_006300708.1| hypothetical protein CARUB_v10019759mg [Caps... 59 1e-06 gb|AAG52558.1|AC010675_6 putative alpha-amylase; 60344-64829 [Ar... 59 1e-06 gb|AAG31655.1| PRLI-interacting factor E [Arabidopsis thaliana] 59 1e-06 ref|NP_564977.1| alpha-amylase-like 3 [Arabidopsis thaliana] gi|... 59 1e-06 ref|XP_006574559.1| PREDICTED: alpha-amylase 3, chloroplastic-li... 56 7e-06 >ref|XP_006390960.1| hypothetical protein EUTSA_v10018099mg [Eutrema salsugineum] gi|557087394|gb|ESQ28246.1| hypothetical protein EUTSA_v10018099mg [Eutrema salsugineum] Length = 900 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG YDPP+ SKNW +AVEG DYKVWETS Sbjct: 869 MKIGPGHYDPPNGSKNWSVAVEGRDYKVWETS 900 >ref|XP_002888741.1| hypothetical protein ARALYDRAFT_339218 [Arabidopsis lyrata subsp. lyrata] gi|297334582|gb|EFH65000.1| hypothetical protein ARALYDRAFT_339218 [Arabidopsis lyrata subsp. lyrata] Length = 882 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG Y+PP+ SKNW +AVEG DYKVWETS Sbjct: 851 MKIGPGHYEPPNGSKNWSVAVEGRDYKVWETS 882 >ref|XP_006300708.1| hypothetical protein CARUB_v10019759mg [Capsella rubella] gi|482569418|gb|EOA33606.1| hypothetical protein CARUB_v10019759mg [Capsella rubella] Length = 900 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG Y+PP+ S+NW +AVEG DYKVWETS Sbjct: 869 MKIGPGHYEPPNGSQNWSVAVEGRDYKVWETS 900 >gb|AAG52558.1|AC010675_6 putative alpha-amylase; 60344-64829 [Arabidopsis thaliana] Length = 826 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG Y+PP+ S+NW +AVEG DYKVWETS Sbjct: 795 MKIGPGHYEPPNGSQNWSVAVEGRDYKVWETS 826 >gb|AAG31655.1| PRLI-interacting factor E [Arabidopsis thaliana] Length = 120 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG Y+PP+ S+NW +AVEG DYKVWETS Sbjct: 89 MKIGPGHYEPPNGSQNWSVAVEGRDYKVWETS 120 >ref|NP_564977.1| alpha-amylase-like 3 [Arabidopsis thaliana] gi|75306316|sp|Q94A41.1|AMY3_ARATH RecName: Full=Alpha-amylase 3, chloroplastic; Short=AtAMY3; AltName: Full=1,4-alpha-D-glucan glucanohydrolase; Flags: Precursor gi|15215738|gb|AAK91414.1| At1g69830/T17F3_14 [Arabidopsis thaliana] gi|23308479|gb|AAN18209.1| At1g69830/T17F3_14 [Arabidopsis thaliana] gi|332196862|gb|AEE34983.1| alpha-amylase-like 3 [Arabidopsis thaliana] Length = 887 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG Y+PP+ S+NW +AVEG DYKVWETS Sbjct: 856 MKIGPGHYEPPNGSQNWSVAVEGRDYKVWETS 887 >ref|XP_006574559.1| PREDICTED: alpha-amylase 3, chloroplastic-like [Glycine max] Length = 928 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 617 MKIGPGKYDPPSESKNWVLAVEGSDYKVWETS 522 MKIGPG ++PPS+S+ W LA+EG DYK+WE S Sbjct: 897 MKIGPGHFEPPSDSQKWSLAIEGKDYKIWEAS 928