BLASTX nr result
ID: Papaver27_contig00044287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00044287 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Mimulus... 57 3e-06 gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Mimulus... 57 3e-06 >gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Mimulus guttatus] Length = 117 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 433 GIKMDKAAALPRQCGVNIPYQISPATDCAKVK 338 G+ + KAAALP QCGVNIPY+ISP+TDC+KVK Sbjct: 86 GVNLGKAAALPGQCGVNIPYKISPSTDCSKVK 117 >gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Mimulus guttatus] Length = 117 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 433 GIKMDKAAALPRQCGVNIPYQISPATDCAKVK 338 G+ + KAAALP QCGVNIPY+ISP+TDC+KVK Sbjct: 86 GVNLGKAAALPGQCGVNIPYKISPSTDCSKVK 117