BLASTX nr result
ID: Papaver27_contig00043897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00043897 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248352.1| PREDICTED: two-pore potassium channel 1-like... 56 5e-06 >ref|XP_004248352.1| PREDICTED: two-pore potassium channel 1-like [Solanum lycopersicum] Length = 349 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/59 (52%), Positives = 42/59 (71%), Gaps = 5/59 (8%) Frame = +1 Query: 232 IGSVKRRIRRSASAPI-DFIPQE----KDDCAVPRNQSIFSNLHPSFRQVPLILALYLG 393 + S +RR+RR SAP+ +FIP E KDD ++PR +SI + LHPSFR+V L L +YLG Sbjct: 21 VDSRRRRLRRLKSAPMPEFIPGEMNDIKDDQSLPRYESILNKLHPSFRKVILYLVIYLG 79