BLASTX nr result
ID: Papaver27_contig00043841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00043841 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26946.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002280167.1| PREDICTED: origin recognition complex subuni... 61 2e-07 emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] 61 2e-07 ref|XP_002312422.1| origin recognition complex subunit 4 family ... 58 2e-06 ref|XP_006344196.1| PREDICTED: origin recognition complex subuni... 57 3e-06 ref|XP_004238875.1| PREDICTED: origin recognition complex subuni... 56 6e-06 >emb|CBI26946.3| unnamed protein product [Vitis vinifera] Length = 425 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 101 AEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 AE+ALILLRSRICNPNFVF+ SD PDSNYSKL Sbjct: 8 AEDALILLRSRICNPNFVFTPFSDSPDSNYSKL 40 >ref|XP_002280167.1| PREDICTED: origin recognition complex subunit 4-like [Vitis vinifera] Length = 418 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 101 AEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 AE+ALILLRSRICNPNFVF+ SD PDSNYSKL Sbjct: 8 AEDALILLRSRICNPNFVFTPFSDSPDSNYSKL 40 >emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] Length = 847 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 101 AEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 AE+ALILLRSRICNPNFVF+ SD PDSNYSKL Sbjct: 8 AEDALILLRSRICNPNFVFTPFSDSPDSNYSKL 40 >ref|XP_002312422.1| origin recognition complex subunit 4 family protein [Populus trichocarpa] gi|222852242|gb|EEE89789.1| origin recognition complex subunit 4 family protein [Populus trichocarpa] Length = 431 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 119 METSKAAEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 M AE+A IL+RSR+CNPNF+F LSD PDSNYSKL Sbjct: 1 MGIENLAEKAQILIRSRLCNPNFIFKPLSDSPDSNYSKL 39 >ref|XP_006344196.1| PREDICTED: origin recognition complex subunit 4-like [Solanum tuberosum] Length = 419 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 119 METSKAAEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 M AE+A ILLR+R+CNPNF+F+ SD PDSNYSKL Sbjct: 1 MGVENPAEQAQILLRTRLCNPNFIFTIFSDSPDSNYSKL 39 >ref|XP_004238875.1| PREDICTED: origin recognition complex subunit 4-like [Solanum lycopersicum] Length = 419 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 119 METSKAAEEALILLRSRICNPNFVFSALSDKPDSNYSKL 3 M AE+A ILLR+R+CNPNF+++ SD PDSNYSKL Sbjct: 1 MGVENPAEQAQILLRTRLCNPNFIYTIFSDSPDSNYSKL 39