BLASTX nr result
ID: Papaver27_contig00043512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00043512 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus... 71 1e-10 ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 71 2e-10 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 71 2e-10 ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phas... 70 2e-10 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 70 2e-10 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 70 3e-10 ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Popu... 70 3e-10 ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prun... 70 4e-10 ref|XP_007035559.1| Mitochondrial substrate carrier family prote... 69 9e-10 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 67 2e-09 ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 5e-09 ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 5e-09 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 66 6e-09 ref|XP_007154266.1| hypothetical protein PHAVU_003G104200g [Phas... 65 8e-09 ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putat... 65 8e-09 ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosph... 65 1e-08 ref|XP_003529575.1| PREDICTED: mitochondrial thiamine pyrophosph... 64 2e-08 ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 >gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus guttatus] Length = 329 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HHAY ++DAL RI+ E WAGLY GI+P ++KAAPA AVTFV +E+TS Sbjct: 273 HHAYKNMYDALTRIMQAEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFTS 321 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +3 Query: 6 HAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HAY ++D L RIL+ E WAGLY GI+P VIKAAPA AVTFV +EYTS Sbjct: 276 HAYKNMYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTS 323 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +3 Query: 6 HAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HAY ++D L RIL+ E WAGLY GI+P VIKAAPA AVTFV +EYTS Sbjct: 276 HAYKNMYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTS 323 >ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] gi|561011985|gb|ESW10892.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] Length = 328 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HHAYN +FDA+ RIL E WAGLY GI+P +KAAPA AVTFV +E TS Sbjct: 272 HHAYNNMFDAIKRILQKEGWAGLYKGIVPSTVKAAPANAVTFVAYELTS 320 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY +FDAL RIL TE WAGLY GI+P +KAAPA AVTFV +E+TS Sbjct: 285 HRAYRNMFDALRRILQTEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTS 333 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HHAY +FDAL RIL E WAGLY GI+P +KAAPA AVTF+ +E+TS Sbjct: 286 HHAYKNMFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTS 334 >ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] gi|550311966|gb|ERP48141.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] Length = 305 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HHAY +FDAL RIL E WAGLY GI+P +KAAPA AVTF+ +E+TS Sbjct: 249 HHAYKNMFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTS 297 >ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY +FDAL RIL E WAGLY GI+P +KAAPA AVTFV +EYTS Sbjct: 275 HRAYRNMFDALRRILQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTS 323 >ref|XP_007035559.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508714588|gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HHAY +FDAL RIL E W GLY GI+P IKAAPA AVTFV +E+TS Sbjct: 274 HHAYMNMFDALRRILQLEGWHGLYKGIVPSTIKAAPAGAVTFVAYEFTS 322 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY ++DAL +IL+ E WAGLY GI+P +IK+APA AVTFV +E+TS Sbjct: 274 HRAYTNMYDALRQILLVEGWAGLYKGIVPSIIKSAPAGAVTFVAYEFTS 322 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 9 AYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 AY ++D L RIL+ E WAGLY GI+P ++KAAPA AVTFV +EYTS Sbjct: 275 AYKNMYDGLRRILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTS 321 >ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Fragaria vesca subsp. vesca] Length = 330 Score = 66.2 bits (160), Expect = 5e-09 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY+ + DAL RI+ E WAGLY GI+P +KAAPA AVTFV +EYTS Sbjct: 275 HRAYSNMVDALRRIVQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTS 323 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 6 HAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 HAY ++DAL I+ E WAGLY GI+P +IKAAPA AVTFV +EYTS Sbjct: 314 HAYKNMWDALRGIVQAEGWAGLYKGIVPSIIKAAPAGAVTFVAYEYTS 361 >ref|XP_007154266.1| hypothetical protein PHAVU_003G104200g [Phaseolus vulgaris] gi|561027620|gb|ESW26260.1| hypothetical protein PHAVU_003G104200g [Phaseolus vulgaris] Length = 331 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY +FDA+ RI+ E WAGLY GIIP +KAAPA AVTFV +E TS Sbjct: 275 HRAYRNMFDAMQRIMRLEGWAGLYKGIIPSTVKAAPAGAVTFVAYELTS 323 >ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 331 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY + DAL RIL E WAGLY GI+P IKAAPA AVTFV +E+TS Sbjct: 275 HRAYRNMADALRRILQAEGWAGLYKGILPSTIKAAPAGAVTFVAYEFTS 323 >ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer arietinum] Length = 333 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY +FD L RIL E WAGLY GI+P +KAAPA AVTFV +E TS Sbjct: 277 HRAYRNMFDGLRRILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYELTS 325 >ref|XP_003529575.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Glycine max] Length = 331 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY + DA+ RIL E WAGLY GIIP +KAAPA AVTFV +E TS Sbjct: 275 HRAYRNMLDAMQRILQLEGWAGLYKGIIPSTVKAAPAGAVTFVAYELTS 323 >ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521481|gb|ESR32848.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 268 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY + DAL RI+ E WAGLY GI+P +KAAPA AVTFV +EY S Sbjct: 212 HRAYRNMSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYAS 260 >ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|568871878|ref|XP_006489106.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Citrus sinensis] gi|557521480|gb|ESR32847.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 333 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY + DAL RI+ E WAGLY GI+P +KAAPA AVTFV +EY S Sbjct: 277 HRAYRNMSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYAS 325 >ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521478|gb|ESR32845.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 241 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 3 HHAYNGIFDALWRILVTERWAGLY*GIIPFVIKAAPAAAVTFVTHEYTS 149 H AY + DAL RI+ E WAGLY GI+P +KAAPA AVTFV +EY S Sbjct: 185 HRAYRNMSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYAS 233