BLASTX nr result
ID: Papaver27_contig00042566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00042566 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511509.1| nitrate transporter, putative [Ricinus commu... 73 4e-11 ref|XP_002317995.2| proton-dependent oligopeptide transport fami... 72 6e-11 ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transpor... 72 8e-11 ref|XP_006476666.1| PREDICTED: probable peptide/nitrate transpor... 72 8e-11 ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transpor... 72 8e-11 ref|XP_006439664.1| hypothetical protein CICLE_v10019319mg [Citr... 72 8e-11 ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citr... 72 8e-11 ref|XP_007037199.1| Major facilitator superfamily protein isofor... 70 2e-10 ref|XP_007037198.1| Major facilitator superfamily protein isofor... 70 2e-10 ref|XP_007037197.1| Major facilitator superfamily protein isofor... 70 2e-10 ref|XP_007037196.1| Major facilitator superfamily protein isofor... 70 2e-10 emb|CBI15285.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002266777.1| PREDICTED: probable peptide/nitrate transpor... 70 2e-10 ref|XP_002300021.1| hypothetical protein POPTR_0001s34640g [Popu... 70 2e-10 ref|XP_007210270.1| hypothetical protein PRUPE_ppa003155mg [Prun... 70 3e-10 ref|XP_002270558.2| PREDICTED: probable peptide/nitrate transpor... 70 3e-10 ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transpor... 69 7e-10 ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citr... 69 7e-10 ref|XP_006439661.1| hypothetical protein CICLE_v10019426mg [Citr... 69 7e-10 gb|ADH21397.1| nitrate transporter [Citrus trifoliata] 69 7e-10 >ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis] gi|223550624|gb|EEF52111.1| nitrate transporter, putative [Ricinus communis] Length = 602 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/70 (48%), Positives = 46/70 (65%) Frame = +3 Query: 6 SSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARWXXXXXXXXXXXXXENDAIEMA 185 ++GNWLAEDLN G+LDY+YY+IA LGVLNFGYFL+ A+W +A+ + Sbjct: 539 ATGNWLAEDLNKGRLDYYYYLIAALGVLNFGYFLICAKWYKYKG---------GNAVTIE 589 Query: 186 KAITKQPTEK 215 K+P+EK Sbjct: 590 MTREKKPSEK 599 >ref|XP_002317995.2| proton-dependent oligopeptide transport family protein [Populus trichocarpa] gi|550326577|gb|EEE96215.2| proton-dependent oligopeptide transport family protein [Populus trichocarpa] Length = 607 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL+EDLN G+LDY+YYMIA LGVLN GYFL+ ARW Sbjct: 547 AATGNWLSEDLNKGRLDYYYYMIAALGVLNMGYFLLCARW 586 >ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 441 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL EDLN G+LDY+YYMIAGL VLN GYFLV ARW Sbjct: 372 AATGNWLPEDLNKGRLDYYYYMIAGLEVLNLGYFLVYARW 411 >ref|XP_006476666.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like isoform X2 [Citrus sinensis] Length = 594 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL EDLN G+LDY+YYMIAGL VLN GYFLV ARW Sbjct: 525 AATGNWLPEDLNKGRLDYYYYMIAGLEVLNLGYFLVYARW 564 >ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like isoform X1 [Citrus sinensis] Length = 621 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL EDLN G+LDY+YYMIAGL VLN GYFLV ARW Sbjct: 552 AATGNWLPEDLNKGRLDYYYYMIAGLEVLNLGYFLVYARW 591 >ref|XP_006439664.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] gi|557541926|gb|ESR52904.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] Length = 457 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL EDLN G+LDY+YYMIAGL VLN GYFLV ARW Sbjct: 388 AATGNWLPEDLNKGRLDYYYYMIAGLEVLNLGYFLVYARW 427 >ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] gi|557541925|gb|ESR52903.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] Length = 621 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A++GNWL EDLN G+LDY+YYMIAGL VLN GYFLV ARW Sbjct: 552 AATGNWLPEDLNKGRLDYYYYMIAGLEVLNLGYFLVYARW 591 >ref|XP_007037199.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao] gi|508774444|gb|EOY21700.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao] Length = 455 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+GNWL EDLN G+LDYFYY IA LGVLN GYFL+ ARW Sbjct: 388 ASTGNWLPEDLNKGRLDYFYYTIACLGVLNLGYFLLCARW 427 >ref|XP_007037198.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] gi|508774443|gb|EOY21699.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] Length = 506 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+GNWL EDLN G+LDYFYY IA LGVLN GYFL+ ARW Sbjct: 439 ASTGNWLPEDLNKGRLDYFYYTIACLGVLNLGYFLLCARW 478 >ref|XP_007037197.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] gi|508774442|gb|EOY21698.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] Length = 598 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+GNWL EDLN G+LDYFYY IA LGVLN GYFL+ ARW Sbjct: 531 ASTGNWLPEDLNKGRLDYFYYTIACLGVLNLGYFLLCARW 570 >ref|XP_007037196.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508774441|gb|EOY21697.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 593 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+GNWL EDLN G+LDYFYY IA LGVLN GYFL+ ARW Sbjct: 526 ASTGNWLPEDLNKGRLDYFYYTIACLGVLNLGYFLLCARW 565 >emb|CBI15285.3| unnamed protein product [Vitis vinifera] Length = 1053 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A+SGNWL EDLN G+LDYFYY++A LGV+N GYFL+ A+W Sbjct: 554 AASGNWLPEDLNKGRLDYFYYLVAALGVINLGYFLLCAKW 593 >ref|XP_002266777.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Vitis vinifera] Length = 586 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A+SGNWL EDLN G+LDYFYY++A LGV+N GYFL+ A+W Sbjct: 522 AASGNWLPEDLNKGRLDYFYYLVAALGVINLGYFLLCAKW 561 >ref|XP_002300021.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa] gi|222847279|gb|EEE84826.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa] Length = 596 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 + +G+WL +DLN GKLDYFYY+IAGLG+LNFGYFL+ A+W Sbjct: 539 SKTGDWLDDDLNKGKLDYFYYVIAGLGILNFGYFLLCAKW 578 >ref|XP_007210270.1| hypothetical protein PRUPE_ppa003155mg [Prunus persica] gi|462406005|gb|EMJ11469.1| hypothetical protein PRUPE_ppa003155mg [Prunus persica] Length = 597 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 +S G+WL EDLN GKLDYFYYM+A L VLNFGYF+V++RW Sbjct: 533 SSMGDWLPEDLNKGKLDYFYYMVAALEVLNFGYFIVLSRW 572 >ref|XP_002270558.2| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Vitis vinifera] Length = 577 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 A +GNWL EDLN G+LDYFYY++A LGV+N GYFLV A+W Sbjct: 527 AKTGNWLPEDLNKGRLDYFYYLVASLGVINLGYFLVCAKW 566 >ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 588 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+G+WL EDLN G+LDYFYY++A LG+LNFG+FL+ A+W Sbjct: 524 ASTGDWLPEDLNKGRLDYFYYLVAALGLLNFGFFLLCAKW 563 >ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] gi|557541924|gb|ESR52902.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] Length = 588 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+G+WL EDLN G+LDYFYY++A LG+LNFG+FL+ A+W Sbjct: 524 ASTGDWLPEDLNKGRLDYFYYLVAALGLLNFGFFLLCAKW 563 >ref|XP_006439661.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] gi|557541923|gb|ESR52901.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] Length = 484 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+G+WL EDLN G+LDYFYY++A LG+LNFG+FL+ A+W Sbjct: 420 ASTGDWLPEDLNKGRLDYFYYLVAALGLLNFGFFLLCAKW 459 >gb|ADH21397.1| nitrate transporter [Citrus trifoliata] Length = 588 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +3 Query: 3 ASSGNWLAEDLNDGKLDYFYYMIAGLGVLNFGYFLVVARW 122 AS+G+WL EDLN G+LDYFYY++A LG+LNFG+FL+ A+W Sbjct: 524 ASTGDWLPEDLNKGRLDYFYYLVAALGLLNFGFFLLCAKW 563