BLASTX nr result
ID: Papaver27_contig00041392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00041392 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40698.1| hypothetical protein MIMGU_mgv1a021759mg, partial... 55 3e-08 >gb|EYU40698.1| hypothetical protein MIMGU_mgv1a021759mg, partial [Mimulus guttatus] Length = 463 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +3 Query: 144 LTKEGKTDSDLWRLAWGPVG-AVEFEKYRVNGFAFSPRYEED-RGT*DSGICIEAY 305 L+KE +T + +WRL GP A ++KYRVNGF FSP+Y +D T DSG+C++A+ Sbjct: 269 LSKETETKAMMWRLVQGPRHEAKSYKKYRVNGFVFSPKYHDDIVVTQDSGVCMKAW 324 Score = 28.9 bits (63), Expect(2) = 3e-08 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 311 WYGLINQILELDYTTLLEKI 370 WYG+I QILELD T E + Sbjct: 343 WYGVIKQILELDCTLFKEVV 362