BLASTX nr result
ID: Papaver27_contig00041364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00041364 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006600746.1| PREDICTED: topless-related protein 4-like is... 62 1e-07 ref|XP_003549747.1| PREDICTED: topless-related protein 4-like is... 62 1e-07 ref|XP_006594237.1| PREDICTED: topless-related protein 4-like is... 61 1e-07 ref|XP_006594236.1| PREDICTED: topless-related protein 4-like is... 61 1e-07 gb|EYU21684.1| hypothetical protein MIMGU_mgv1a000459mg [Mimulus... 58 1e-06 ref|XP_007155035.1| hypothetical protein PHAVU_003G167500g [Phas... 58 1e-06 ref|XP_007155034.1| hypothetical protein PHAVU_003G167500g [Phas... 58 1e-06 ref|XP_007155033.1| hypothetical protein PHAVU_003G167500g [Phas... 58 1e-06 ref|XP_007155032.1| hypothetical protein PHAVU_003G167500g [Phas... 58 1e-06 ref|XP_006369294.1| WD-40 repeat family protein [Populus trichoc... 58 2e-06 ref|XP_006597113.1| PREDICTED: protein TOPLESS-like isoform X1 [... 57 3e-06 ref|XP_006595172.1| PREDICTED: protein TOPLESS-like isoform X3 [... 57 3e-06 ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [A... 57 3e-06 ref|XP_004303268.1| PREDICTED: protein TOPLESS-like [Fragaria ve... 57 3e-06 ref|XP_003543688.1| PREDICTED: protein TOPLESS-like isoform X1 [... 57 3e-06 ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [... 57 4e-06 ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [... 57 4e-06 ref|XP_007214907.1| hypothetical protein PRUPE_ppa000478mg [Prun... 57 4e-06 ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communi... 57 4e-06 ref|XP_006584165.1| PREDICTED: protein TOPLESS-like [Glycine max] 56 6e-06 >ref|XP_006600746.1| PREDICTED: topless-related protein 4-like isoform X2 [Glycine max] Length = 1135 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNLA DVK RI +E+VEKS+IWKLTEINEPSQCR Sbjct: 734 DTRNLA-DVKPRIVDESVEKSRIWKLTEINEPSQCR 768 >ref|XP_003549747.1| PREDICTED: topless-related protein 4-like isoform X1 [Glycine max] Length = 1134 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNLA DVK RI +E+VEKS+IWKLTEINEPSQCR Sbjct: 733 DTRNLA-DVKPRIVDESVEKSRIWKLTEINEPSQCR 767 >ref|XP_006594237.1| PREDICTED: topless-related protein 4-like isoform X2 [Glycine max] Length = 1132 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNLA DVK RI +E VEKS+IWKLTEINEPSQCR Sbjct: 731 DTRNLA-DVKPRIVDEAVEKSRIWKLTEINEPSQCR 765 >ref|XP_006594236.1| PREDICTED: topless-related protein 4-like isoform X1 [Glycine max] Length = 1133 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNLA DVK RI +E VEKS+IWKLTEINEPSQCR Sbjct: 732 DTRNLA-DVKPRIVDEAVEKSRIWKLTEINEPSQCR 766 >gb|EYU21684.1| hypothetical protein MIMGU_mgv1a000459mg [Mimulus guttatus] Length = 1138 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNL DVK RI EET +KSKIWKL+EINEPSQCR Sbjct: 731 DTRNLG-DVKPRIIEETNDKSKIWKLSEINEPSQCR 765 >ref|XP_007155035.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] gi|561028389|gb|ESW27029.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] Length = 1132 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTR+LA DVK RI +E V+KS+IWKLTEINEPSQCR Sbjct: 731 DTRSLA-DVKPRIVDEAVDKSRIWKLTEINEPSQCR 765 >ref|XP_007155034.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] gi|561028388|gb|ESW27028.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] Length = 1131 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTR+LA DVK RI +E V+KS+IWKLTEINEPSQCR Sbjct: 730 DTRSLA-DVKPRIVDEAVDKSRIWKLTEINEPSQCR 764 >ref|XP_007155033.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] gi|561028387|gb|ESW27027.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] Length = 1129 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTR+LA DVK RI +E V+KS+IWKLTEINEPSQCR Sbjct: 728 DTRSLA-DVKPRIVDEAVDKSRIWKLTEINEPSQCR 762 >ref|XP_007155032.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] gi|561028386|gb|ESW27026.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris] Length = 1128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTR+LA DVK RI +E V+KS+IWKLTEINEPSQCR Sbjct: 727 DTRSLA-DVKPRIVDEAVDKSRIWKLTEINEPSQCR 761 >ref|XP_006369294.1| WD-40 repeat family protein [Populus trichocarpa] gi|550347754|gb|ERP65863.1| WD-40 repeat family protein [Populus trichocarpa] Length = 1153 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL DVK R+TEE+ +KSKIWKLTEINEPSQCR Sbjct: 747 DARNLG-DVKPRLTEESNDKSKIWKLTEINEPSQCR 781 >ref|XP_006597113.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max] gi|571514504|ref|XP_006597114.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max] Length = 1130 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL DVK RI+EE+ +KSKIWKLTEINEPSQCR Sbjct: 726 DARNLG-DVKPRISEESNDKSKIWKLTEINEPSQCR 760 >ref|XP_006595172.1| PREDICTED: protein TOPLESS-like isoform X3 [Glycine max] Length = 1110 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL DVK RI+EE+ +KSKIWKLTEINEPSQCR Sbjct: 706 DARNLG-DVKPRISEESNDKSKIWKLTEINEPSQCR 740 >ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda] gi|548858916|gb|ERN16630.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda] Length = 1138 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D R++ DVK RIT+E++EKSKIWKLTEINEPSQCR Sbjct: 732 DNRSVG-DVKPRITDESMEKSKIWKLTEINEPSQCR 766 >ref|XP_004303268.1| PREDICTED: protein TOPLESS-like [Fragaria vesca subsp. vesca] Length = 1138 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 + RNL DVK RITEE+ +KSKIWKLTEINEPSQCR Sbjct: 732 EARNLG-DVKPRITEESNDKSKIWKLTEINEPSQCR 766 >ref|XP_003543688.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max] gi|571503861|ref|XP_006595171.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max] Length = 1132 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL DVK RI+EE+ +KSKIWKLTEINEPSQCR Sbjct: 728 DARNLG-DVKPRISEESNDKSKIWKLTEINEPSQCR 762 >ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [Cicer arietinum] Length = 1149 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL D+K RI+EE+ +KSKIWKLTEINEPSQCR Sbjct: 745 DARNLG-DIKPRISEESNDKSKIWKLTEINEPSQCR 779 >ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [Cicer arietinum] Length = 1150 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL D+K RI+EE+ +KSKIWKLTEINEPSQCR Sbjct: 745 DARNLG-DIKPRISEESNDKSKIWKLTEINEPSQCR 779 >ref|XP_007214907.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica] gi|462411057|gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica] Length = 1139 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RNL DVK RI EE+ +KSKIWKLTEINEPSQCR Sbjct: 734 DARNLG-DVKPRIAEESNDKSKIWKLTEINEPSQCR 768 >ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis] gi|223543333|gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis] Length = 1115 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 D RN+ DVK RITEE+ +KSKIWKLTEINEP+QCR Sbjct: 709 DARNMG-DVKPRITEESNDKSKIWKLTEINEPTQCR 743 >ref|XP_006584165.1| PREDICTED: protein TOPLESS-like [Glycine max] Length = 1074 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 118 DTRNLAADVKTRITEETVEKSKIWKLTEINEPSQCR 225 DTRNL DVK RI+EE+ +KSKIWKLTEINE SQCR Sbjct: 670 DTRNLG-DVKPRISEESNDKSKIWKLTEINEQSQCR 704