BLASTX nr result
ID: Papaver27_contig00040935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040935 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357984.1| PREDICTED: probable tyrosine-protein phospha... 60 4e-07 ref|XP_006357983.1| PREDICTED: probable tyrosine-protein phospha... 60 4e-07 ref|XP_006357982.1| PREDICTED: probable tyrosine-protein phospha... 60 4e-07 ref|XP_004243503.1| PREDICTED: probable tyrosine-protein phospha... 60 4e-07 gb|AAX20039.1| tyrosine specific protein phosphatase family prot... 60 4e-07 ref|XP_002317187.2| hypothetical protein POPTR_0011s00950g [Popu... 59 5e-07 ref|XP_004491093.1| PREDICTED: probable tyrosine-protein phospha... 59 5e-07 ref|XP_007215960.1| hypothetical protein PRUPE_ppa011399mg [Prun... 59 5e-07 gb|AFK49097.1| unknown [Medicago truncatula] 59 5e-07 ref|XP_003616881.1| Tyrosine specific protein phosphatase family... 59 5e-07 ref|NP_001266990.1| probable tyrosine-protein phosphatase At1g05... 59 7e-07 gb|EXC27243.1| putative tyrosine-protein phosphatase [Morus nota... 59 9e-07 ref|XP_006595833.1| PREDICTED: probable tyrosine-protein phospha... 58 1e-06 ref|XP_006595832.1| PREDICTED: probable tyrosine-protein phospha... 58 1e-06 ref|XP_006575576.1| PREDICTED: probable tyrosine-protein phospha... 58 1e-06 ref|XP_007141657.1| hypothetical protein PHAVU_008G214300g [Phas... 58 1e-06 ref|XP_007141656.1| hypothetical protein PHAVU_008G214300g [Phas... 58 1e-06 ref|XP_006829495.1| hypothetical protein AMTR_s00074p00106610 [A... 58 1e-06 ref|XP_003545201.1| PREDICTED: probable tyrosine-protein phospha... 58 1e-06 ref|XP_002273080.2| PREDICTED: probable tyrosine-protein phospha... 58 2e-06 >ref|XP_006357984.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X3 [Solanum tuberosum] Length = 192 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D F+PPLNF+MVDNG+FRSGFP V NF+FL+T Sbjct: 66 DFFIPPLNFAMVDNGIFRSGFPDVDNFSFLQT 97 >ref|XP_006357983.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X2 [Solanum tuberosum] Length = 230 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D F+PPLNF+MVDNG+FRSGFP V NF+FL+T Sbjct: 66 DFFIPPLNFAMVDNGIFRSGFPDVDNFSFLQT 97 >ref|XP_006357982.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X1 [Solanum tuberosum] Length = 244 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D F+PPLNF+MVDNG+FRSGFP V NF+FL+T Sbjct: 66 DFFIPPLNFAMVDNGIFRSGFPDVDNFSFLQT 97 >ref|XP_004243503.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Solanum lycopersicum] Length = 230 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D F+PPLNF+MVDNG+FRSGFP V NF+FL+T Sbjct: 66 DFFIPPLNFAMVDNGIFRSGFPDVDNFSFLQT 97 >gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum annuum] Length = 225 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 + F+PPLNFSMVDNG+FRSGFP V+NF+FL+T Sbjct: 61 EFFIPPLNFSMVDNGIFRSGFPDVANFSFLQT 92 >ref|XP_002317187.2| hypothetical protein POPTR_0011s00950g [Populus trichocarpa] gi|550327270|gb|EEE97799.2| hypothetical protein POPTR_0011s00950g [Populus trichocarpa] Length = 258 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 ++FVPPLNF+MVDNG+FRSGFP ++NFTFL++ Sbjct: 94 ELFVPPLNFAMVDNGIFRSGFPDIANFTFLQS 125 >ref|XP_004491093.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cicer arietinum] Length = 219 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP SNF+FL+T Sbjct: 55 DLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQT 86 >ref|XP_007215960.1| hypothetical protein PRUPE_ppa011399mg [Prunus persica] gi|462412110|gb|EMJ17159.1| hypothetical protein PRUPE_ppa011399mg [Prunus persica] Length = 212 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNFSMVDNG+FRSGFP +NF+FL+T Sbjct: 48 DLFIPPLNFSMVDNGIFRSGFPESANFSFLQT 79 >gb|AFK49097.1| unknown [Medicago truncatula] Length = 220 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP SNF+FL+T Sbjct: 56 DLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQT 87 >ref|XP_003616881.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|355518216|gb|AES99839.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] Length = 220 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP SNF+FL+T Sbjct: 56 DLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQT 87 >ref|NP_001266990.1| probable tyrosine-protein phosphatase At1g05000-like [Fragaria vesca] gi|334724823|gb|AEH02866.1| tyrosine-protein phosphatase [Fragaria vesca] Length = 208 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP SNF+FL+T Sbjct: 44 DLFMPPLNFAMVDNGIFRSGFPDSSNFSFLQT 75 >gb|EXC27243.1| putative tyrosine-protein phosphatase [Morus notabilis] Length = 225 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 55 DLFIPPLNFAMVDNGIFRSGFPDSANFSFLQT 86 >ref|XP_006595833.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X3 [Glycine max] Length = 193 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 50 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 81 >ref|XP_006595832.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X2 [Glycine max] Length = 194 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 50 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 81 >ref|XP_006575576.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] Length = 208 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 44 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 75 >ref|XP_007141657.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] gi|561014790|gb|ESW13651.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] Length = 214 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 50 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 81 >ref|XP_007141656.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] gi|561014789|gb|ESW13650.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] Length = 194 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 50 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 81 >ref|XP_006829495.1| hypothetical protein AMTR_s00074p00106610 [Amborella trichopoda] gi|548834979|gb|ERM96911.1| hypothetical protein AMTR_s00074p00106610 [Amborella trichopoda] Length = 168 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 390 MFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 +FVPPLNF+MVD+GVFRSGFP ++NF+FLET Sbjct: 16 LFVPPLNFAMVDHGVFRSGFPDITNFSFLET 46 >ref|XP_003545201.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X1 [Glycine max] Length = 216 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 D+F+PPLNF+MVDNG+FRSGFP +NF+FL+T Sbjct: 50 DLFIPPLNFAMVDNGIFRSGFPEPANFSFLQT 81 >ref|XP_002273080.2| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Vitis vinifera] Length = 210 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 387 DMFVPPLNFSMVDNGVFRSGFPGVSNFTFLET 482 ++FVPPLNF+MVD GVFRSGFP ++NFTFL+T Sbjct: 43 ELFVPPLNFAMVDCGVFRSGFPDIANFTFLQT 74