BLASTX nr result
ID: Papaver27_contig00040724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040724 (739 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528573.1| Ran GTPase binding protein, putative [Ricinu... 71 3e-10 ref|XP_002316910.2| regulator of chromosome condensation family ... 70 6e-10 ref|XP_006464722.1| PREDICTED: probable E3 ubiquitin-protein lig... 69 2e-09 ref|XP_006464721.1| PREDICTED: probable E3 ubiquitin-protein lig... 69 2e-09 ref|XP_006451921.1| hypothetical protein CICLE_v10008120mg [Citr... 69 2e-09 ref|XP_006451920.1| hypothetical protein CICLE_v10008120mg [Citr... 69 2e-09 gb|EXB76306.1| hypothetical protein L484_025664 [Morus notabilis] 68 4e-09 ref|XP_006592904.1| PREDICTED: probable E3 ubiquitin-protein lig... 67 8e-09 ref|XP_003540454.1| PREDICTED: probable E3 ubiquitin-protein lig... 67 8e-09 ref|XP_007149599.1| hypothetical protein PHAVU_005G083200g [Phas... 66 1e-08 ref|XP_007149598.1| hypothetical protein PHAVU_005G083200g [Phas... 66 1e-08 ref|XP_006406968.1| hypothetical protein EUTSA_v10020606mg [Eutr... 66 1e-08 ref|NP_566512.1| regulator of chromosome condensation 1 [Arabido... 65 2e-08 gb|AAK59406.1| unknown protein [Arabidopsis thaliana] 65 2e-08 ref|XP_003543252.1| PREDICTED: probable E3 ubiquitin-protein lig... 65 2e-08 gb|ACU23737.1| unknown [Glycine max] 65 2e-08 ref|XP_006370290.1| regulator of chromosome condensation family ... 65 2e-08 ref|XP_007021354.1| Regulator of chromosome condensation (RCC1) ... 65 3e-08 ref|XP_007021353.1| Regulator of chromosome condensation (RCC1) ... 65 3e-08 ref|XP_007021352.1| Regulator of chromosome condensation (RCC1) ... 65 3e-08 >ref|XP_002528573.1| Ran GTPase binding protein, putative [Ricinus communis] gi|223532017|gb|EEF33828.1| Ran GTPase binding protein, putative [Ricinus communis] Length = 497 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 AD+ RLVSIDELPSHL+L+IL +GRL+A+DL CLE TS+ F G+HG P Sbjct: 2 ADKYRLVSIDELPSHLILEILMTGRLSATDLVCLELTSKTFGGSHGLYP 50 >ref|XP_002316910.2| regulator of chromosome condensation family protein [Populus trichocarpa] gi|550328218|gb|EEE97522.2| regulator of chromosome condensation family protein [Populus trichocarpa] Length = 492 Score = 70.5 bits (171), Expect = 6e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 AD+ R VSI++LPSHL+ +ILT+GRL+A DLACLE TSR F G+HG PQ Sbjct: 2 ADKNRSVSIEDLPSHLIFEILTTGRLSAVDLACLELTSRTFGGSHGLYPQ 51 >ref|XP_006464722.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like isoform X2 [Citrus sinensis] Length = 488 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 ADR RL SI+ELPSHL+ +ILTSGRL+A DLA LE TS+ F G+HG PQ Sbjct: 2 ADRYRLFSIEELPSHLIFEILTSGRLSAVDLAHLELTSKTFGGSHGLYPQ 51 >ref|XP_006464721.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like isoform X1 [Citrus sinensis] Length = 489 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 ADR RL SI+ELPSHL+ +ILTSGRL+A DLA LE TS+ F G+HG PQ Sbjct: 2 ADRYRLFSIEELPSHLIFEILTSGRLSAVDLAHLELTSKTFGGSHGLYPQ 51 >ref|XP_006451921.1| hypothetical protein CICLE_v10008120mg [Citrus clementina] gi|557555147|gb|ESR65161.1| hypothetical protein CICLE_v10008120mg [Citrus clementina] Length = 489 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 ADR RL SI+ELPSHL+ +ILTSGRL+A DLA LE TS+ F G+HG PQ Sbjct: 2 ADRYRLFSIEELPSHLIFEILTSGRLSAVDLAHLELTSKTFGGSHGLYPQ 51 >ref|XP_006451920.1| hypothetical protein CICLE_v10008120mg [Citrus clementina] gi|557555146|gb|ESR65160.1| hypothetical protein CICLE_v10008120mg [Citrus clementina] Length = 390 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 ADR RL SI+ELPSHL+ +ILTSGRL+A DLA LE TS+ F G+HG PQ Sbjct: 2 ADRYRLFSIEELPSHLIFEILTSGRLSAVDLAHLELTSKTFGGSHGLYPQ 51 >gb|EXB76306.1| hypothetical protein L484_025664 [Morus notabilis] Length = 492 Score = 67.8 bits (164), Expect = 4e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 +R R VSIDELPSHL+L+IL+SG L+A DL CLE TSR F G+HG PQ Sbjct: 3 ERYRPVSIDELPSHLILEILSSGGLSAVDLVCLELTSRTFGGSHGLYPQ 51 >ref|XP_006592904.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X2 [Glycine max] Length = 415 Score = 66.6 bits (161), Expect = 8e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 DR R SI+ELPSHLVL+IL SGRL+A DL CLE TS+ F G+HG P Sbjct: 3 DRCRHFSIEELPSHLVLEILCSGRLSAMDLVCLELTSKTFGGSHGLHP 50 >ref|XP_003540454.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X1 [Glycine max] Length = 485 Score = 66.6 bits (161), Expect = 8e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 DR R SI+ELPSHLVL+IL SGRL+A DL CLE TS+ F G+HG P Sbjct: 3 DRCRHFSIEELPSHLVLEILCSGRLSAMDLVCLELTSKTFGGSHGLHP 50 >ref|XP_007149599.1| hypothetical protein PHAVU_005G083200g [Phaseolus vulgaris] gi|561022863|gb|ESW21593.1| hypothetical protein PHAVU_005G083200g [Phaseolus vulgaris] Length = 364 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 DR R SI+ELPSHLVLDIL SGRL+A DL CLE TS+ F G HG P Sbjct: 3 DRCRHFSIEELPSHLVLDILCSGRLSAMDLVCLELTSKTFGGIHGLYP 50 >ref|XP_007149598.1| hypothetical protein PHAVU_005G083200g [Phaseolus vulgaris] gi|561022862|gb|ESW21592.1| hypothetical protein PHAVU_005G083200g [Phaseolus vulgaris] Length = 478 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 DR R SI+ELPSHLVLDIL SGRL+A DL CLE TS+ F G HG P Sbjct: 3 DRCRHFSIEELPSHLVLDILCSGRLSAMDLVCLELTSKTFGGIHGLYP 50 >ref|XP_006406968.1| hypothetical protein EUTSA_v10020606mg [Eutrema salsugineum] gi|557108114|gb|ESQ48421.1| hypothetical protein EUTSA_v10020606mg [Eutrema salsugineum] Length = 488 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 A+R L+S ++LPSHL+L++LTSGRLNA DL LE TS++F G++GFSP Sbjct: 2 AERNWLISFEDLPSHLILEVLTSGRLNAVDLLSLELTSKVFGGSYGFSP 50 >ref|NP_566512.1| regulator of chromosome condensation 1 [Arabidopsis thaliana] gi|42572455|ref|NP_974323.1| regulator of chromosome condensation 1 [Arabidopsis thaliana] gi|7021728|gb|AAF35409.1| unknown protein [Arabidopsis thaliana] gi|15795108|dbj|BAB02372.1| unnamed protein product [Arabidopsis thaliana] gi|23297250|gb|AAN12924.1| unknown protein [Arabidopsis thaliana] gi|332642152|gb|AEE75673.1| regulator of chromosome condensation 1 [Arabidopsis thaliana] gi|332642153|gb|AEE75674.1| regulator of chromosome condensation 1 [Arabidopsis thaliana] Length = 488 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 ADR L+S ++LPSHL+L++LTSGRL+A DL LE TS++F G+HGF P Sbjct: 2 ADRNCLISFEDLPSHLILEVLTSGRLSAVDLLSLELTSKVFGGSHGFYP 50 >gb|AAK59406.1| unknown protein [Arabidopsis thaliana] Length = 488 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 ADR L+S ++LPSHL+L++LTSGRL+A DL LE TS++F G+HGF P Sbjct: 2 ADRNCLISFEDLPSHLILEVLTSGRLSAVDLLSLELTSKVFGGSHGFYP 50 >ref|XP_003543252.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Glycine max] Length = 485 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 +R R SI+ELPSHLVL+IL SGRL+A DL CLE TS+ F G+HG P Sbjct: 3 ERCRHFSIEELPSHLVLEILCSGRLSAMDLVCLELTSKTFGGSHGLHP 50 >gb|ACU23737.1| unknown [Glycine max] Length = 485 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 589 DRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSP 732 +R R SI+ELPSHLVL+IL SGRL+A DL CLE TS+ F G+HG P Sbjct: 3 ERCRHFSIEELPSHLVLEILCSGRLSAMDLVCLELTSKTFGGSHGLHP 50 >ref|XP_006370290.1| regulator of chromosome condensation family protein [Populus trichocarpa] gi|550349469|gb|ERP66859.1| regulator of chromosome condensation family protein [Populus trichocarpa] Length = 492 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSGRLNASDLACLEQTSRMFRGNHGFSPQ 735 A+R RL SI++ PSHL+ +ILT GRL+A+DL CLE TSR F +HG PQ Sbjct: 2 ANRYRLASIEDFPSHLIFEILTIGRLSAADLVCLELTSRTFGASHGLYPQ 51 >ref|XP_007021354.1| Regulator of chromosome condensation (RCC1) family protein isoform 3, partial [Theobroma cacao] gi|508720982|gb|EOY12879.1| Regulator of chromosome condensation (RCC1) family protein isoform 3, partial [Theobroma cacao] Length = 385 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSG-RLNASDLACLEQTSRMFRGNHGFSP 732 ADR+RL SI+ELPSHL+L+ILTSG RL+A DL LE TSR F G+HG P Sbjct: 2 ADRSRLFSIEELPSHLILEILTSGERLSAVDLVSLELTSRTFGGSHGVYP 51 >ref|XP_007021353.1| Regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] gi|508720981|gb|EOY12878.1| Regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] Length = 393 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSG-RLNASDLACLEQTSRMFRGNHGFSP 732 ADR+RL SI+ELPSHL+L+ILTSG RL+A DL LE TSR F G+HG P Sbjct: 2 ADRSRLFSIEELPSHLILEILTSGERLSAVDLVSLELTSRTFGGSHGVYP 51 >ref|XP_007021352.1| Regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] gi|508720980|gb|EOY12877.1| Regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] Length = 493 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 586 ADRARLVSIDELPSHLVLDILTSG-RLNASDLACLEQTSRMFRGNHGFSP 732 ADR+RL SI+ELPSHL+L+ILTSG RL+A DL LE TSR F G+HG P Sbjct: 2 ADRSRLFSIEELPSHLILEILTSGERLSAVDLVSLELTSRTFGGSHGVYP 51