BLASTX nr result
ID: Papaver27_contig00039906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039906 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis] 58 1e-06 ref|XP_002524160.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002524154.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis] Length = 714 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/86 (37%), Positives = 37/86 (43%) Frame = +3 Query: 3 PYGXXXXXXXXXXXXENNKDLRMCKRLTHSRYGNSTGSWIGSSPGATRAARKLLRKKDFA 182 PYG N+D+ C R+THSRY NST SW S AA L K + Sbjct: 628 PYGDIFTIDIDPDDIYMNEDVEKCNRITHSRYENSTASWTTFSTEDPNAAWNLQLDKVYT 687 Query: 183 RALPCPYLGGEEGSQMTGHPVFPNEC 260 + P Y G E MTGH P C Sbjct: 688 PSCPYAYCDGGETWHMTGHLCIPKRC 713 >ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis] gi|223536578|gb|EEF38223.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/86 (36%), Positives = 37/86 (43%) Frame = +3 Query: 3 PYGXXXXXXXXXXXXENNKDLRMCKRLTHSRYGNSTGSWIGSSPGATRAARKLLRKKDFA 182 PYG NKD++ R+THSRY NST +W S A LL K + Sbjct: 638 PYGDVFTVDIDPDDINKNKDVKKFNRITHSRYENSTPTWTMFSTEDPNATWNLLLKDSYT 697 Query: 183 RALPCPYLGGEEGSQMTGHPVFPNEC 260 + P Y G E MTGH P C Sbjct: 698 PSCPYAYPDGGESWHMTGHLCIPKRC 723 >ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis] gi|223536572|gb|EEF38217.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/86 (36%), Positives = 37/86 (43%) Frame = +3 Query: 3 PYGXXXXXXXXXXXXENNKDLRMCKRLTHSRYGNSTGSWIGSSPGATRAARKLLRKKDFA 182 PYG NKD++ R+THSRY NST +W S A LL K + Sbjct: 638 PYGDVFTVDIDPDDINKNKDVKKFNRITHSRYENSTPTWTMFSTEDPNATWNLLLKDSYT 697 Query: 183 RALPCPYLGGEEGSQMTGHPVFPNEC 260 + P Y G E MTGH P C Sbjct: 698 PSCPYAYPDGGESWHMTGHLCIPRRC 723