BLASTX nr result
ID: Papaver27_contig00039728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039728 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007023000.1| GTP-binding family protein isoform 1 [Theobr... 39 9e-06 ref|XP_007023001.1| GTP-binding family protein isoform 2 [Theobr... 39 9e-06 >ref|XP_007023000.1| GTP-binding family protein isoform 1 [Theobroma cacao] gi|508778366|gb|EOY25622.1| GTP-binding family protein isoform 1 [Theobroma cacao] Length = 551 Score = 38.5 bits (88), Expect(3) = 9e-06 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = -2 Query: 367 MRRKNIYKAYKMKDRLDPEDFLVQVYRRSGKLLWGDD 257 ++++++ +AYK+KD +D DFLVQ+ + +GKLL G + Sbjct: 399 VKKEHLERAYKIKDWVDENDFLVQLCQSTGKLLKGGE 435 Score = 29.6 bits (65), Expect(3) = 9e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 267 GATMVLHDWQRG*RPY 220 GA M+LHDWQRG P+ Sbjct: 441 GAKMILHDWQRGRIPF 456 Score = 25.8 bits (55), Expect(3) = 9e-06 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 386 IGEVLKHAKKEHIQ 345 IGEVLK KKEH++ Sbjct: 392 IGEVLKRVKKEHLE 405 >ref|XP_007023001.1| GTP-binding family protein isoform 2 [Theobroma cacao] gi|508778367|gb|EOY25623.1| GTP-binding family protein isoform 2 [Theobroma cacao] Length = 513 Score = 38.5 bits (88), Expect(3) = 9e-06 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = -2 Query: 367 MRRKNIYKAYKMKDRLDPEDFLVQVYRRSGKLLWGDD 257 ++++++ +AYK+KD +D DFLVQ+ + +GKLL G + Sbjct: 361 VKKEHLERAYKIKDWVDENDFLVQLCQSTGKLLKGGE 397 Score = 29.6 bits (65), Expect(3) = 9e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 267 GATMVLHDWQRG*RPY 220 GA M+LHDWQRG P+ Sbjct: 403 GAKMILHDWQRGRIPF 418 Score = 25.8 bits (55), Expect(3) = 9e-06 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 386 IGEVLKHAKKEHIQ 345 IGEVLK KKEH++ Sbjct: 354 IGEVLKRVKKEHLE 367