BLASTX nr result
ID: Papaver27_contig00039521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039521 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004516443.1| PREDICTED: UDP-glycosyltransferase 89A2-like... 55 8e-06 >ref|XP_004516443.1| PREDICTED: UDP-glycosyltransferase 89A2-like [Cicer arietinum] Length = 467 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 100 HILVFPFPAQGHMLPLLDLVHQLAVRSTTTTT 5 HILVFP+PAQGHMLPLLDL H LA+++T T T Sbjct: 7 HILVFPYPAQGHMLPLLDLTHHLALQTTLTIT 38