BLASTX nr result
ID: Papaver27_contig00039513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039513 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26696.1| hypothetical protein MIMGU_mgv1a002575mg [Mimulus... 55 8e-06 >gb|EYU26696.1| hypothetical protein MIMGU_mgv1a002575mg [Mimulus guttatus] Length = 657 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = -3 Query: 484 SIFVISGLKTIETLTETVECYKEGGGWSFVNPKGAGKRCFSTSIFM 347 SI+VI G++T E + + +ECYKEG GW N GKRCF+++I + Sbjct: 609 SIYVIGGIQTDEEIVDQIECYKEGRGWEATNLSAVGKRCFASAIVL 654