BLASTX nr result
ID: Papaver27_contig00039431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039431 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315224.1| glycosyl transferase family 2 family protein... 68 2e-09 ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutr... 66 4e-09 ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases supe... 65 8e-09 ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabi... 65 1e-08 ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransf... 65 1e-08 ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prun... 64 2e-08 ref|XP_003518645.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 64 2e-08 ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 64 2e-08 ref|XP_007139212.1| hypothetical protein PHAVU_008G010800g [Phas... 64 2e-08 ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citr... 64 2e-08 ref|XP_006293498.1| hypothetical protein CARUB_v10023563mg [Caps... 64 2e-08 ref|XP_006345962.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 61 1e-07 ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase,... 61 1e-07 ref|XP_002312095.1| glycosyl transferase family 2 family protein... 61 1e-07 gb|EXC30501.1| hypothetical protein L484_010749 [Morus notabilis] 61 2e-07 ref|XP_004492149.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 61 2e-07 ref|XP_004239791.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 61 2e-07 ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 61 2e-07 emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] 61 2e-07 ref|XP_004307516.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 60 2e-07 >ref|XP_002315224.1| glycosyl transferase family 2 family protein [Populus trichocarpa] gi|222864264|gb|EEF01395.1| glycosyl transferase family 2 family protein [Populus trichocarpa] Length = 335 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+L SIP+ML EL LMSVGYRTR+W I Sbjct: 294 EISVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTRMWKI 333 >ref|XP_006411189.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] gi|557112358|gb|ESQ52642.1| hypothetical protein EUTSA_v10016901mg [Eutrema salsugineum] Length = 336 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKVSL SIP+ML EL LMSVGYRT +W I Sbjct: 294 EISVNWSEIPGSKVSLLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_007009343.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] gi|508726256|gb|EOY18153.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 335 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 128 EISV WSEIPGSKV+ SIP+ML EL LMSVGYRTR+W I + Sbjct: 294 EISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTRMWKINS 335 >ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] gi|297327505|gb|EFH57925.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 294 EISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|NP_181493.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|591402142|gb|AHL38798.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 336 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKVS+ SIP+ML EL LMSVGYRT +W I Sbjct: 294 EISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_007218274.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] gi|462414736|gb|EMJ19473.1| hypothetical protein PRUPE_ppa008313mg [Prunus persica] Length = 337 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIRA 128 EISV WSEIPGSKV+ SIP+ML EL LMSVGYRT +W IR+ Sbjct: 296 EISVNWSEIPGSKVNPLSIPNMLWELVLMSVGYRTGMWQIRS 337 >ref|XP_003518645.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Glycine max] gi|571439407|ref|XP_006574851.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Glycine max] gi|571439409|ref|XP_006574852.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X3 [Glycine max] Length = 333 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+L SIP+ML EL LMSVGYRT +W I Sbjct: 290 EISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_003552702.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Glycine max] Length = 333 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+L SIP+ML EL LMSVGYRT +W I Sbjct: 290 EISVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_007139212.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|593331574|ref|XP_007139213.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|561012345|gb|ESW11206.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] gi|561012346|gb|ESW11207.1| hypothetical protein PHAVU_008G010800g [Phaseolus vulgaris] Length = 333 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 E+SV WSEIPGSKV+L SIP+ML EL LMSVGYRT +W I Sbjct: 290 EVSVNWSEIPGSKVNLLSIPNMLWELVLMSVGYRTGMWRI 329 >ref|XP_006435986.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] gi|568865484|ref|XP_006486104.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Citrus sinensis] gi|557538182|gb|ESR49226.1| hypothetical protein CICLE_v10032053mg [Citrus clementina] Length = 335 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIR 125 EISV WSEIPGSKV+ SIP+ML EL LMSVGYRT +W +R Sbjct: 294 EISVNWSEIPGSKVNPLSIPNMLWELALMSVGYRTGMWKVR 334 >ref|XP_006293498.1| hypothetical protein CARUB_v10023563mg [Capsella rubella] gi|482562206|gb|EOA26396.1| hypothetical protein CARUB_v10023563mg [Capsella rubella] Length = 342 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV++ SIP+ML EL LMSVGYRT +W I Sbjct: 294 EISVKWSEIPGSKVNMLSIPNMLWELALMSVGYRTGMWKI 333 >ref|XP_006345962.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Solanum tuberosum] Length = 335 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV W+EIPGSKV+L SIP+ML E+ +MS+GYRT +W I Sbjct: 294 EISVNWTEIPGSKVNLLSIPNMLWEMAIMSLGYRTGIWKI 333 >ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi|223529581|gb|EEF31531.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] Length = 335 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+ SIP+ML EL +MS+GYRT +W I Sbjct: 294 EISVNWSEIPGSKVNPLSIPNMLWELAIMSIGYRTGMWEI 333 >ref|XP_002312095.1| glycosyl transferase family 2 family protein [Populus trichocarpa] gi|222851915|gb|EEE89462.1| glycosyl transferase family 2 family protein [Populus trichocarpa] Length = 335 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV W+EIPGSKV+ SIP+ML EL L+S+GYRTR+W I Sbjct: 294 EISVNWTEIPGSKVNPLSIPNMLWELALVSMGYRTRMWKI 333 >gb|EXC30501.1| hypothetical protein L484_010749 [Morus notabilis] Length = 383 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSIR 125 E SV WSEIPGSKV+L SI +ML EL LMSVGYRT +W IR Sbjct: 296 ETSVNWSEIPGSKVNLLSILNMLWELALMSVGYRTGMWRIR 336 >ref|XP_004492149.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cicer arietinum] Length = 333 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+L SIP+M+ EL LMSVGYR +W I Sbjct: 290 EISVNWSEIPGSKVNLLSIPNMVWELLLMSVGYRIGIWRI 329 >ref|XP_004239791.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Solanum lycopersicum] Length = 335 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV W+EIPGSKV+L SIP+ML E+ +MS+GYRT +W I Sbjct: 294 EISVNWTEIPGSKVNLLSIPNMLWEMAIMSLGYRTGIWRI 333 >ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|296086237|emb|CBI31678.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+ SIP+ML EL LMS GYRT +W I Sbjct: 295 EISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 334 >emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] Length = 251 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+ SIP+ML EL LMS GYRT +W I Sbjct: 210 EISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMWKI 249 >ref|XP_004307516.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Fragaria vesca subsp. vesca] Length = 333 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 EISVTWSEIPGSKVSLRSIPHMLGELCLMSVGYRTRLWSI 122 EISV WSEIPGSKV+ SIP+ML EL LMSVGYR+ +W I Sbjct: 292 EISVNWSEIPGSKVNPLSIPNMLWELVLMSVGYRSSMWRI 331