BLASTX nr result
ID: Papaver27_contig00039397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039397 (727 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006411875.1| hypothetical protein EUTSA_v10025180mg [Eutr... 41 1e-05 >ref|XP_006411875.1| hypothetical protein EUTSA_v10025180mg [Eutrema salsugineum] gi|557113045|gb|ESQ53328.1| hypothetical protein EUTSA_v10025180mg [Eutrema salsugineum] Length = 452 Score = 41.2 bits (95), Expect(3) = 1e-05 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = +1 Query: 19 PEWEMLPSEAARKNLGRENGENCDSK 96 PEWEM+ EAAR GRENG NCD K Sbjct: 222 PEWEMIAKEAARTIPGRENGGNCDIK 247 Score = 33.5 bits (75), Expect(3) = 1e-05 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 114 PEFMEGAK*YS-DMH*L*GDDEVSFYVAIDMSDILEFK 224 P F+EGA + DMH GD E+SF AI+MS LE K Sbjct: 258 PVFVEGANLSTGDMHFSQGDGEISFCGAIEMSGFLELK 295 Score = 20.4 bits (41), Expect(3) = 1e-05 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 95 KNLSRGS*IY 124 KNLSRGS IY Sbjct: 247 KNLSRGSKIY 256