BLASTX nr result
ID: Papaver27_contig00039299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00039299 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226570.1| hypothetical protein PRUPE_ppa024322mg [Prun... 55 8e-06 >ref|XP_007226570.1| hypothetical protein PRUPE_ppa024322mg [Prunus persica] gi|462423506|gb|EMJ27769.1| hypothetical protein PRUPE_ppa024322mg [Prunus persica] Length = 309 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 3 SIPFDDLKRLGIPPPPEGRYMTLHQVXXXXXXXXNYVD*EE 125 SIP+DDL+RLGIPPPPEGRYM+ +QV N VD EE Sbjct: 180 SIPYDDLERLGIPPPPEGRYMSRYQVPSPPRRKRNSVDREE 220