BLASTX nr result
ID: Papaver27_contig00038453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00038453 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006389821.1| hypothetical protein EUTSA_v10018796mg [Eutr... 58 1e-06 ref|XP_002274315.1| PREDICTED: rae1-like protein At1g80670 [Viti... 57 3e-06 gb|EXC10040.1| Rae1-like protein [Morus notabilis] 56 6e-06 ref|NP_178182.1| Rae1-like protein [Arabidopsis thaliana] gi|833... 56 6e-06 ref|XP_007148431.1| hypothetical protein PHAVU_006G208000g [Phas... 55 8e-06 ref|XP_006827060.1| hypothetical protein AMTR_s00010p00233620 [A... 55 8e-06 ref|XP_002271645.1| PREDICTED: rae1-like protein At1g80670 [Viti... 55 8e-06 >ref|XP_006389821.1| hypothetical protein EUTSA_v10018796mg [Eutrema salsugineum] gi|557086255|gb|ESQ27107.1| hypothetical protein EUTSA_v10018796mg [Eutrema salsugineum] Length = 348 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVGTGRK 388 NPATAKS+IFLHLPQESEVK KPRV TGRK Sbjct: 319 NPATAKSSIFLHLPQESEVKAKPRVATGRK 348 >ref|XP_002274315.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|297743618|emb|CBI36485.3| unnamed protein product [Vitis vinifera] Length = 345 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVGTGRK 388 NP+TAK+ IFLHLPQESEVKGKPRVGT RK Sbjct: 316 NPSTAKNHIFLHLPQESEVKGKPRVGTSRK 345 >gb|EXC10040.1| Rae1-like protein [Morus notabilis] Length = 349 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVGT-GRK 388 NPATAK+ IFLHLPQESEVKGKPRVGT GRK Sbjct: 319 NPATAKTHIFLHLPQESEVKGKPRVGTSGRK 349 >ref|NP_178182.1| Rae1-like protein [Arabidopsis thaliana] gi|83305440|sp|Q38942.2|RAE1L_ARATH RecName: Full=Rae1-like protein At1g80670 gi|6503279|gb|AAF14655.1|AC011713_3 F23A5.2(form2) [Arabidopsis thaliana] gi|21593271|gb|AAM65220.1| mRNA export protein, putative [Arabidopsis thaliana] gi|94442413|gb|ABF18994.1| At1g80670 [Arabidopsis thaliana] gi|332198314|gb|AEE36435.1| Rae1-like protein [Arabidopsis thaliana] Length = 349 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVG-TGRK 388 NPATAKS+IFLHLPQESEVK KPRVG TGRK Sbjct: 319 NPATAKSSIFLHLPQESEVKAKPRVGATGRK 349 >ref|XP_007148431.1| hypothetical protein PHAVU_006G208000g [Phaseolus vulgaris] gi|561021654|gb|ESW20425.1| hypothetical protein PHAVU_006G208000g [Phaseolus vulgaris] Length = 347 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/31 (87%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVG-TGRK 388 NPATAK+ IFLHLPQESEVKGKPR+G TGRK Sbjct: 317 NPATAKTYIFLHLPQESEVKGKPRIGATGRK 347 >ref|XP_006827060.1| hypothetical protein AMTR_s00010p00233620 [Amborella trichopoda] gi|548831489|gb|ERM94297.1| hypothetical protein AMTR_s00010p00233620 [Amborella trichopoda] Length = 348 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVGTGRK 388 NPATAK+ IFLH PQESEVKGKPRV +GRK Sbjct: 319 NPATAKTNIFLHTPQESEVKGKPRVASGRK 348 >ref|XP_002271645.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|296081523|emb|CBI20046.3| unnamed protein product [Vitis vinifera] Length = 350 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/31 (87%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -3 Query: 477 NPATAKSTIFLHLPQESEVKGKPRVGT-GRK 388 NPATAKS IFLHLPQE+EVKGKPR+GT GRK Sbjct: 320 NPATAKSYIFLHLPQEAEVKGKPRIGTSGRK 350