BLASTX nr result
ID: Papaver27_contig00035463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00035463 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019123.1| Eukaryotic aspartyl protease family protein,... 59 5e-07 >ref|XP_007019123.1| Eukaryotic aspartyl protease family protein, putative [Theobroma cacao] gi|508724451|gb|EOY16348.1| Eukaryotic aspartyl protease family protein, putative [Theobroma cacao] Length = 463 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +2 Query: 2 VIYDNEKQEIGWATANCDRLPNIDRE--EDLSQLDTAGLDILTEDYGPGASGFQKEYEES 175 V+YDNEKQ+IGW +ANCDRLPN+D + ED+ Q A IL E + P K Sbjct: 400 VVYDNEKQQIGWVSANCDRLPNLDSDYNEDIQQPYAANFGILEEKH-PATQASSKRNMRV 458 Query: 176 HKKD 187 H+++ Sbjct: 459 HRRE 462