BLASTX nr result
ID: Papaver27_contig00033903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00033903 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 4... 90 3e-16 ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 4... 90 3e-16 ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4... 88 1e-15 ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4... 88 1e-15 gb|EYU41331.1| hypothetical protein MIMGU_mgv1a008704mg [Mimulus... 87 3e-15 ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 82 6e-14 ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4... 82 8e-14 ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4... 79 5e-13 ref|XP_006346898.1| PREDICTED: U-box domain-containing protein 4... 78 1e-12 ref|XP_004234710.1| PREDICTED: U-box domain-containing protein 4... 77 2e-12 ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4... 74 3e-11 ref|XP_003519339.1| PREDICTED: U-box domain-containing protein 4... 74 3e-11 ref|XP_007141888.1| hypothetical protein PHAVU_008G234200g [Phas... 72 8e-11 ref|XP_006408302.1| hypothetical protein EUTSA_v10020852mg [Eutr... 70 4e-10 ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4... 70 4e-10 ref|XP_007215526.1| hypothetical protein PRUPE_ppa007075mg [Prun... 69 9e-10 ref|XP_002882294.1| armadillo/beta-catenin repeat family protein... 68 1e-09 ref|NP_186994.2| ARM repeat superfamily protein [Arabidopsis tha... 68 1e-09 gb|AAF01591.1|AC009895_12 unknown protein [Arabidopsis thaliana] 68 1e-09 ref|XP_006372596.1| hypothetical protein POPTR_0017s03080g [Popu... 67 2e-09 >ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 4-like isoform 2 [Solanum lycopersicum] Length = 373 Score = 90.1 bits (222), Expect = 3e-16 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V QT+ LIQS+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 456 LLALLNL 476 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 4-like isoform 1 [Solanum lycopersicum] Length = 389 Score = 90.1 bits (222), Expect = 3e-16 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V QT+ LIQS+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 456 LLALLNL 476 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Solanum tuberosum] Length = 373 Score = 88.2 bits (217), Expect = 1e-15 Identities = 47/67 (70%), Positives = 55/67 (82%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V QT+ LI S+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 456 LLALLNL 476 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Solanum tuberosum] Length = 389 Score = 88.2 bits (217), Expect = 1e-15 Identities = 47/67 (70%), Positives = 55/67 (82%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V QT+ LI S+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 456 LLALLNL 476 LLALLNL Sbjct: 94 LLALLNL 100 >gb|EYU41331.1| hypothetical protein MIMGU_mgv1a008704mg [Mimulus guttatus] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 48/77 (62%), Positives = 58/77 (75%) Frame = +3 Query: 246 SETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR 425 S S VNQT+ +L+QS+DP S++ AAKDIRRLTKTSQ+ RRHFSGA+ LV MLR Sbjct: 10 SSLSSSSAATVNQTL-VLLQSDDPNSRVLAAKDIRRLTKTSQRSRRHFSGAVGPLVDMLR 68 Query: 426 SNSVEFNEASLLALLNL 476 +S E NEA+L ALLNL Sbjct: 69 CSSAEANEAALAALLNL 85 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 82.4 bits (202), Expect = 6e-14 Identities = 49/83 (59%), Positives = 64/83 (77%) Frame = +3 Query: 228 EPDSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQY 407 +PD+ + T + VN+T+ LL QS+DP S+IQAAK+IRRLTKTSQK RR S A++ Sbjct: 13 DPDTPRTATTA-----VNRTLHLL-QSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRP 66 Query: 408 LVSMLRSNSVEFNEASLLALLNL 476 LVSMLR +S++ NEA+LLALLNL Sbjct: 67 LVSMLRLDSLDSNEAALLALLNL 89 >ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 361 Score = 82.0 bits (201), Expect = 8e-14 Identities = 46/69 (66%), Positives = 57/69 (82%), Gaps = 1/69 (1%) Frame = +3 Query: 273 IVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR-SNSVEFNE 449 IV +T+ LIQS+DP K+Q A+DIRRLTK+S +YRRHFS A++ LV MLR S SVE+NE Sbjct: 5 IVEKTL-YLIQSDDPILKLQGARDIRRLTKSSLRYRRHFSDAVKPLVDMLRNSPSVEYNE 63 Query: 450 ASLLALLNL 476 A+LLALLNL Sbjct: 64 AALLALLNL 72 >ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 419 Score = 79.3 bits (194), Expect = 5e-13 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +3 Query: 294 LLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEASLLALLN 473 LLIQS+D K+QAA++IRRLTKTS++YRR+FS A++ LV ML SNS E EA+LLALLN Sbjct: 74 LLIQSDDLTLKVQAAREIRRLTKTSKRYRRYFSNAVKSLVHMLHSNSFESKEAALLALLN 133 Query: 474 L 476 L Sbjct: 134 L 134 >ref|XP_006346898.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 377 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/61 (65%), Positives = 51/61 (83%) Frame = +3 Query: 294 LLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEASLLALLN 473 LLIQS+D K+QAA++IRRLTKTS++YRR+FS +++ LV ML SNS E EA+LLALLN Sbjct: 32 LLIQSDDLTLKVQAAREIRRLTKTSKRYRRYFSNSVKSLVHMLHSNSFESKEAALLALLN 91 Query: 474 L 476 L Sbjct: 92 L 92 >ref|XP_004234710.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 361 Score = 77.0 bits (188), Expect = 2e-12 Identities = 44/69 (63%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = +3 Query: 273 IVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR-SNSVEFNE 449 IV +T+ LIQS++P K+Q A+DIRRLTK+ +YRR+FS AI+ LV MLR S SVE+NE Sbjct: 5 IVEKTL-YLIQSDNPILKLQGARDIRRLTKSCLRYRRYFSDAIKPLVDMLRHSESVEYNE 63 Query: 450 ASLLALLNL 476 A+LLALLNL Sbjct: 64 AALLALLNL 72 >ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 371 Score = 73.6 bits (179), Expect = 3e-11 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V + +ELL Q NDP ++QAA+DIRRLTKTSQ+ RR A+ LVSMLR +S EF+E + Sbjct: 15 VRRALELL-QLNDPVLRVQAARDIRRLTKTSQRCRRQLRQAVAPLVSMLRVDSPEFHEPA 73 Query: 456 LLALLNL 476 LLALLNL Sbjct: 74 LLALLNL 80 >ref|XP_003519339.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 371 Score = 73.6 bits (179), Expect = 3e-11 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V + +ELL Q NDP ++QAA+DIRRLTKTSQ+ RR A+ LVSMLR +S EF+E + Sbjct: 15 VRRALELL-QLNDPVLRVQAARDIRRLTKTSQRCRRQLRQAVAPLVSMLRVDSSEFHEPA 73 Query: 456 LLALLNL 476 LLALLNL Sbjct: 74 LLALLNL 80 >ref|XP_007141888.1| hypothetical protein PHAVU_008G234200g [Phaseolus vulgaris] gi|561015021|gb|ESW13882.1| hypothetical protein PHAVU_008G234200g [Phaseolus vulgaris] Length = 366 Score = 72.0 bits (175), Expect = 8e-11 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = +3 Query: 276 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 455 V + +ELL Q NDP ++QAA+DIRRLTK S + RRH A+ LVSMLR +S +F+E + Sbjct: 12 VRRALELL-QLNDPVLRVQAARDIRRLTKNSHRCRRHLRQAVSPLVSMLRVDSPDFHEPA 70 Query: 456 LLALLNL 476 LLALLNL Sbjct: 71 LLALLNL 77 >ref|XP_006408302.1| hypothetical protein EUTSA_v10020852mg [Eutrema salsugineum] gi|557109448|gb|ESQ49755.1| hypothetical protein EUTSA_v10020852mg [Eutrema salsugineum] Length = 406 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/61 (63%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = +3 Query: 297 LIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVE-FNEASLLALLN 473 LI+S DP S++ AA++IRRLTKTS + RRHFS A++ LVSMLR +S E +EA+LLALLN Sbjct: 70 LIRSEDPDSRLFAAREIRRLTKTSHRCRRHFSQAVEPLVSMLRFDSPESHHEAALLALLN 129 Query: 474 L 476 L Sbjct: 130 L 130 >ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 384 Score = 69.7 bits (169), Expect = 4e-10 Identities = 40/74 (54%), Positives = 53/74 (71%) Frame = +3 Query: 255 DSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNS 434 + + P V + ++LL S DP ++QAA+DIRRLTKTSQ+ RR S A+ LVSMLR +S Sbjct: 22 EPRTPLAVRRALQLL-NSGDPDLRLQAARDIRRLTKTSQRCRRQLSQAVGPLVSMLRVDS 80 Query: 435 VEFNEASLLALLNL 476 E +E +LLALLNL Sbjct: 81 PESHEPALLALLNL 94 >ref|XP_007215526.1| hypothetical protein PRUPE_ppa007075mg [Prunus persica] gi|462411676|gb|EMJ16725.1| hypothetical protein PRUPE_ppa007075mg [Prunus persica] Length = 383 Score = 68.6 bits (166), Expect = 9e-10 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 1/83 (1%) Frame = +3 Query: 231 PDSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYL 410 PDS S T S P Q LIQS+D SK+Q A++IRRLTKTS + RR S ++ L Sbjct: 14 PDSSSSPTSS--PSSAVQRALQLIQSDDQDSKLQGAQEIRRLTKTSHRCRRQLSASVGPL 71 Query: 411 VSMLR-SNSVEFNEASLLALLNL 476 VSMLR +S E +E++LLALLNL Sbjct: 72 VSMLRVRDSTESHESALLALLNL 94 >ref|XP_002882294.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328134|gb|EFH58553.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 68.2 bits (165), Expect = 1e-09 Identities = 44/85 (51%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +3 Query: 225 MEPDSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQ 404 + P +S + S I Q + LI+S D S++ AAK+IRRLTKTS + RRHFS A++ Sbjct: 50 VSPSVSVSISSSSSASI--QRVLSLIRSKDLDSRLFAAKEIRRLTKTSHRCRRHFSQAVE 107 Query: 405 YLVSMLRSNSVE-FNEASLLALLNL 476 LVSMLR +S E +EA+LLALLNL Sbjct: 108 PLVSMLRFDSPESHHEAALLALLNL 132 >ref|NP_186994.2| ARM repeat superfamily protein [Arabidopsis thaliana] gi|332640423|gb|AEE73944.1| ARM repeat superfamily protein [Arabidopsis thaliana] Length = 408 Score = 67.8 bits (164), Expect = 1e-09 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = +3 Query: 237 SQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVS 416 S +S + S I Q + LI+S D S++ AAK+IRRLTKTS + RRHFS A++ LVS Sbjct: 54 SSVSVSSSSSASI--QRVLSLIRSEDCDSRLFAAKEIRRLTKTSHRCRRHFSQAVEPLVS 111 Query: 417 MLRSNSVE-FNEASLLALLNL 476 MLR +S E +EA+LLALLNL Sbjct: 112 MLRFDSPESHHEAALLALLNL 132 >gb|AAF01591.1|AC009895_12 unknown protein [Arabidopsis thaliana] Length = 417 Score = 67.8 bits (164), Expect = 1e-09 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = +3 Query: 237 SQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVS 416 S +S + S I Q + LI+S D S++ AAK+IRRLTKTS + RRHFS A++ LVS Sbjct: 54 SSVSVSSSSSASI--QRVLSLIRSEDCDSRLFAAKEIRRLTKTSHRCRRHFSQAVEPLVS 111 Query: 417 MLRSNSVE-FNEASLLALLNL 476 MLR +S E +EA+LLALLNL Sbjct: 112 MLRFDSPESHHEAALLALLNL 132 >ref|XP_006372596.1| hypothetical protein POPTR_0017s03080g [Populus trichocarpa] gi|550319225|gb|ERP50393.1| hypothetical protein POPTR_0017s03080g [Populus trichocarpa] Length = 114 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/63 (61%), Positives = 48/63 (76%), Gaps = 3/63 (4%) Frame = +3 Query: 297 LIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR---SNSVEFNEASLLAL 467 LIQS D KI+AAKDIRRLTKTSQ+ RR + A++ LV MLR +SVE +E++LLAL Sbjct: 40 LIQSEDLSLKIEAAKDIRRLTKTSQRCRRQLADAVKPLVCMLRVGDDDSVELSESALLAL 99 Query: 468 LNL 476 LNL Sbjct: 100 LNL 102