BLASTX nr result
ID: Papaver27_contig00033689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00033689 (816 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518240.1| ATP binding protein, putative [Ricinus commu... 66 1e-08 ref|XP_007225224.1| hypothetical protein PRUPE_ppa001920mg [Prun... 65 2e-08 ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, part... 64 9e-08 ref|XP_007011461.1| Kinase protein with adenine nucleotide alpha... 63 1e-07 ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata] gi... 62 2e-07 ref|XP_003631778.1| PREDICTED: U-box domain-containing protein 3... 62 3e-07 emb|CBI20806.3| unnamed protein product [Vitis vinifera] 62 3e-07 ref|XP_006371832.1| hypothetical protein POPTR_0018s04050g, part... 61 6e-07 ref|XP_002266413.2| PREDICTED: U-box domain-containing protein 3... 61 6e-07 emb|CAN79719.1| hypothetical protein VITISV_012742 [Vitis vinifera] 61 6e-07 ref|NP_180014.2| adenine nucleotide alpha hydrolase domain-conta... 60 7e-07 gb|AAD18110.1| putative protein kinase [Arabidopsis thaliana] 60 7e-07 ref|XP_006296408.1| hypothetical protein CARUB_v10025585mg [Caps... 59 2e-06 ref|XP_003588626.1| U-box domain-containing protein [Medicago tr... 59 2e-06 ref|XP_006483740.1| PREDICTED: U-box domain-containing protein 5... 59 3e-06 ref|XP_006450083.1| hypothetical protein CICLE_v10010213mg [Citr... 59 3e-06 ref|XP_006404968.1| hypothetical protein EUTSA_v10000051mg [Eutr... 58 4e-06 >ref|XP_002518240.1| ATP binding protein, putative [Ricinus communis] gi|223542587|gb|EEF44126.1| ATP binding protein, putative [Ricinus communis] Length = 802 Score = 66.2 bits (160), Expect = 1e-08 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTD-RNSRYS 1 +RSPF R G +NGK Y + S+P+TDISFV SSGRPS D+MFP+FYD L+ RN R S Sbjct: 248 FRSPFTRRG-LNGKSYGELSIPDTDISFV-SSGRPSIDRMFPAFYDVLEMGARNQRLS 303 >ref|XP_007225224.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica] gi|462422160|gb|EMJ26423.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica] Length = 741 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G NGK Y D +P+TDIS+VSS GRPS D++FP+FYD+LD+ R Sbjct: 196 FRSPFTRKGP-NGKSYADLPMPDTDISYVSS-GRPSIDRIFPAFYDNLDSGR 245 >ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa] gi|550337363|gb|ERP60005.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa] Length = 784 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G + GK Y + S+P+TDISFVSS GRPS D++FP+FYD+ +T R Sbjct: 260 FRSPFTRRG-LTGKSYGELSVPDTDISFVSS-GRPSIDRIFPAFYDNTETSR 309 >ref|XP_007011461.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain [Theobroma cacao] gi|508781824|gb|EOY29080.1| Kinase protein with adenine nucleotide alpha hydrolases-like domain [Theobroma cacao] Length = 765 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDRNS 10 +RSPF R G +NGK Y + +P+TDISFV+S GRPS D+MFP FYD+ +T R + Sbjct: 212 FRSPFTRRG-LNGKSYPNLHIPDTDISFVTS-GRPSIDRMFPPFYDNQETIRTA 263 >ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata] gi|297326417|gb|EFH56837.1| kinase [Arabidopsis lyrata subsp. lyrata] Length = 788 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G NGK Y D S+PE+DISF+ SSGRPS D++FPS YD+ D R Sbjct: 250 FRSPFTRRG--NGKSYGDLSVPESDISFI-SSGRPSIDRIFPSLYDNNDPTR 298 >ref|XP_003631778.1| PREDICTED: U-box domain-containing protein 35-like [Vitis vinifera] Length = 796 Score = 62.0 bits (149), Expect = 3e-07 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 168 RSPFARGG-GMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYD 34 +SPF RG G NG+ Y + SLP++DISFV SSGRPSTD+MFP FYD Sbjct: 230 KSPFTRGARGPNGRSYGEISLPDSDISFV-SSGRPSTDRMFPPFYD 274 >emb|CBI20806.3| unnamed protein product [Vitis vinifera] Length = 1126 Score = 62.0 bits (149), Expect = 3e-07 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 168 RSPFARGG-GMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYD 34 +SPF RG G NG+ Y + SLP++DISFV SSGRPSTD+MFP FYD Sbjct: 635 KSPFTRGARGPNGRSYGEISLPDSDISFV-SSGRPSTDRMFPPFYD 679 >ref|XP_006371832.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa] gi|550318005|gb|ERP49629.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa] Length = 737 Score = 60.8 bits (146), Expect = 6e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G +NGK Y + S+P++DISFV SSGR S D +FP+FYD+ +T R Sbjct: 221 FRSPFTRRG-LNGKSYGELSVPDSDISFV-SSGRASIDSIFPAFYDNTETSR 270 >ref|XP_002266413.2| PREDICTED: U-box domain-containing protein 35-like [Vitis vinifera] Length = 806 Score = 60.8 bits (146), Expect = 6e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -1 Query: 168 RSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDRN 13 +SPF RG K Y + S+PETDISFV SSGRPS D +FP YD+LDT N Sbjct: 229 KSPFTRGRASLSKSYGELSVPETDISFV-SSGRPSIDHIFPFSYDNLDTGMN 279 >emb|CAN79719.1| hypothetical protein VITISV_012742 [Vitis vinifera] Length = 826 Score = 60.8 bits (146), Expect = 6e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -1 Query: 168 RSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDRN 13 +SPF RG K Y + S+PETDISFV SSGRPS D +FP YD+LDT N Sbjct: 230 KSPFTRGRASLSKSYGELSVPETDISFV-SSGRPSIDHIFPFSYDNLDTGMN 280 >ref|NP_180014.2| adenine nucleotide alpha hydrolase domain-containing protein kinase [Arabidopsis thaliana] gi|91806264|gb|ABE65860.1| protein kinase family protein [Arabidopsis thaliana] gi|330252473|gb|AEC07567.1| adenine nucleotide alpha hydrolase domain-containing protein kinase [Arabidopsis thaliana] Length = 788 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G NG+ Y D ++PE+DISF+SS GRPS D++FPS YD+ D R Sbjct: 250 FRSPFTRRG--NGRSYGDLTVPESDISFISS-GRPSIDRIFPSLYDNNDPSR 298 >gb|AAD18110.1| putative protein kinase [Arabidopsis thaliana] Length = 816 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G NG+ Y D ++PE+DISF+SS GRPS D++FPS YD+ D R Sbjct: 250 FRSPFTRRG--NGRSYGDLTVPESDISFISS-GRPSIDRIFPSLYDNNDPSR 298 >ref|XP_006296408.1| hypothetical protein CARUB_v10025585mg [Capsella rubella] gi|482565116|gb|EOA29306.1| hypothetical protein CARUB_v10025585mg [Capsella rubella] Length = 806 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDH 31 +RSPF R G NG+ Y D S+PE+DISF+ SSGRPS D++FPS YD+ Sbjct: 266 FRSPFTRRG--NGRSYGDLSVPESDISFI-SSGRPSIDRIFPSLYDN 309 >ref|XP_003588626.1| U-box domain-containing protein [Medicago truncatula] gi|355477674|gb|AES58877.1| U-box domain-containing protein [Medicago truncatula] Length = 786 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDRNSRYS 1 +RSPF R N + Y + S+PE DISFVSS GRPSTD++FPS Y+H S +S Sbjct: 244 FRSPFTRRRP-NDRSYGELSMPEGDISFVSSGGRPSTDRLFPSVYNHNCNPDQSSFS 299 >ref|XP_006483740.1| PREDICTED: U-box domain-containing protein 52-like [Citrus sinensis] Length = 802 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 691 SNNNKQFVHRRFRNTDVANSVSKGAPDFCTVYIISKGKM 575 ++NNK F+ RRF+ TDV +VSKGAPDFCTVY+ISKGK+ Sbjct: 140 ASNNKGFL-RRFKTTDVPGNVSKGAPDFCTVYVISKGKI 177 >ref|XP_006450083.1| hypothetical protein CICLE_v10010213mg [Citrus clementina] gi|557553309|gb|ESR63323.1| hypothetical protein CICLE_v10010213mg [Citrus clementina] Length = 1175 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 691 SNNNKQFVHRRFRNTDVANSVSKGAPDFCTVYIISKGKM 575 ++NNK F+ RRF+ TDV +VSKGAPDFCTVY+ISKGK+ Sbjct: 521 ASNNKGFL-RRFKTTDVPGNVSKGAPDFCTVYVISKGKI 558 >ref|XP_006404968.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum] gi|557106096|gb|ESQ46421.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum] Length = 801 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 171 YRSPFARGGGMNGKVYTDFSLPETDISFVSSSGRPSTDQMFPSFYDHLDTDR 16 +RSPF R G G+ Y D S+PE+DISFVSS GRPS D++FP+ YD+ D +R Sbjct: 258 FRSPFTRRG--YGRSYGDLSVPESDISFVSS-GRPSIDRIFPNIYDNNDPNR 306