BLASTX nr result
ID: Papaver27_contig00032995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00032995 (559 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244022.1| PREDICTED: regulatory protein RecX-like [Sol... 40 1e-05 >ref|XP_004244022.1| PREDICTED: regulatory protein RecX-like [Solanum lycopersicum] Length = 310 Score = 39.7 bits (91), Expect(2) = 1e-05 Identities = 18/38 (47%), Positives = 30/38 (78%) Frame = -1 Query: 163 NAYRMSKSSVNHLFVQSSK**LRNEDVPLEKRKARMIK 50 + + +SK S++ L+VQ+SK L+ +D+P EKRKAR+I+ Sbjct: 248 SGHAISKPSLDQLYVQASKQWLKGQDMPREKRKARIIR 285 Score = 35.4 bits (80), Expect(2) = 1e-05 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 51 RWLQYRGFGWGVIKFIL 1 RWLQYRGF W V+ FIL Sbjct: 285 RWLQYRGFDWSVVSFIL 301