BLASTX nr result
ID: Papaver27_contig00032409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00032409 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23389.1| unknown [Picea sitchensis] 60 2e-07 gb|EXC01119.1| Enhancer of rudimentary-like protein [Morus notab... 59 5e-07 ref|XP_006450265.1| hypothetical protein CICLE_v10009999mg [Citr... 59 5e-07 ref|XP_006450264.1| hypothetical protein CICLE_v10009999mg [Citr... 59 5e-07 ref|XP_006845387.1| hypothetical protein AMTR_s00019p00053160 [A... 59 5e-07 ref|XP_004244513.1| PREDICTED: enhancer of rudimentary homolog i... 57 2e-06 ref|XP_004138697.1| PREDICTED: enhancer of rudimentary homolog [... 57 3e-06 ref|XP_002873478.1| hypothetical protein ARALYDRAFT_909041 [Arab... 57 3e-06 ref|XP_004498795.1| PREDICTED: enhancer of rudimentary homolog [... 55 8e-06 ref|XP_006286628.1| hypothetical protein CARUB_v10002447mg [Caps... 55 8e-06 >gb|ABK23389.1| unknown [Picea sitchensis] Length = 103 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLAS 92 VY+ SIQAYLPYDRQWIKHR FQHLKKLA+ Sbjct: 73 VYDHSIQAYLPYDRQWIKHRIFQHLKKLAA 102 >gb|EXC01119.1| Enhancer of rudimentary-like protein [Morus notabilis] Length = 118 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLA 89 VY+ SIQAYLPYDRQWIK RTFQHLKKLA Sbjct: 89 VYDHSIQAYLPYDRQWIKQRTFQHLKKLA 117 >ref|XP_006450265.1| hypothetical protein CICLE_v10009999mg [Citrus clementina] gi|557553491|gb|ESR63505.1| hypothetical protein CICLE_v10009999mg [Citrus clementina] Length = 92 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLA 89 VY+ SIQAYLPYDRQWIK RTFQHLKKLA Sbjct: 63 VYDHSIQAYLPYDRQWIKQRTFQHLKKLA 91 >ref|XP_006450264.1| hypothetical protein CICLE_v10009999mg [Citrus clementina] gi|568860032|ref|XP_006483532.1| PREDICTED: enhancer of rudimentary homolog [Citrus sinensis] gi|557553490|gb|ESR63504.1| hypothetical protein CICLE_v10009999mg [Citrus clementina] Length = 102 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLA 89 VY+ SIQAYLPYDRQWIK RTFQHLKKLA Sbjct: 73 VYDHSIQAYLPYDRQWIKQRTFQHLKKLA 101 >ref|XP_006845387.1| hypothetical protein AMTR_s00019p00053160 [Amborella trichopoda] gi|548847959|gb|ERN07062.1| hypothetical protein AMTR_s00019p00053160 [Amborella trichopoda] Length = 127 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLAS 92 V++ SIQAYLPYDRQWIK RTFQHLKKLAS Sbjct: 97 VFDHSIQAYLPYDRQWIKQRTFQHLKKLAS 126 >ref|XP_004244513.1| PREDICTED: enhancer of rudimentary homolog isoform 2 [Solanum lycopersicum] gi|565381443|ref|XP_006357079.1| PREDICTED: enhancer of rudimentary homolog isoform X1 [Solanum tuberosum] gi|565381445|ref|XP_006357080.1| PREDICTED: enhancer of rudimentary homolog isoform X2 [Solanum tuberosum] Length = 104 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLAS 92 VY+ SIQAYLPYDRQWIK +T QHLKKLAS Sbjct: 73 VYDHSIQAYLPYDRQWIKQKTLQHLKKLAS 102 >ref|XP_004138697.1| PREDICTED: enhancer of rudimentary homolog [Cucumis sativus] gi|449493309|ref|XP_004159251.1| PREDICTED: enhancer of rudimentary homolog [Cucumis sativus] Length = 102 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLA 89 V+E SIQAYLPYDRQWIK R FQHLKKLA Sbjct: 73 VFEHSIQAYLPYDRQWIKQRIFQHLKKLA 101 >ref|XP_002873478.1| hypothetical protein ARALYDRAFT_909041 [Arabidopsis lyrata subsp. lyrata] gi|297319315|gb|EFH49737.1| hypothetical protein ARALYDRAFT_909041 [Arabidopsis lyrata subsp. lyrata] Length = 109 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLASGTR 101 VYE SI AYLPYDRQWIK + F HLK++A+G+R Sbjct: 77 VYEHSISAYLPYDRQWIKQKAFNHLKRIANGSR 109 >ref|XP_004498795.1| PREDICTED: enhancer of rudimentary homolog [Cicer arietinum] Length = 103 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLA 89 VY+ SI AYLP+DRQWIK RTFQHLKKLA Sbjct: 74 VYDSSIHAYLPHDRQWIKQRTFQHLKKLA 102 >ref|XP_006286628.1| hypothetical protein CARUB_v10002447mg [Capsella rubella] gi|482555334|gb|EOA19526.1| hypothetical protein CARUB_v10002447mg [Capsella rubella] Length = 109 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 VYEQSIQAYLPYDRQWIKHRTFQHLKKLASGTR 101 VYE S+ AYLPYDRQWIK + F HLK+LA+G R Sbjct: 77 VYEHSLSAYLPYDRQWIKQKAFNHLKRLANGGR 109