BLASTX nr result
ID: Papaver27_contig00031809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00031809 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623642.1| BTB/POZ domain-containing protein [Medicago ... 75 1e-11 ref|XP_007140048.1| hypothetical protein PHAVU_008G080100g [Phas... 72 6e-11 ref|XP_007208710.1| hypothetical protein PRUPE_ppa003095mg [Prun... 72 6e-11 ref|XP_006602729.1| PREDICTED: BTB/POZ domain-containing protein... 72 1e-10 ref|XP_006602728.1| PREDICTED: BTB/POZ domain-containing protein... 72 1e-10 ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-10 ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-10 ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-10 ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-10 gb|AAG51355.1|AC012562_16 hypothetical protein; 15198-13181 [Ara... 70 4e-10 ref|XP_004492590.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-10 ref|XP_002269960.2| PREDICTED: BTB/POZ domain-containing protein... 70 4e-10 ref|XP_002884684.1| hypothetical protein ARALYDRAFT_478155 [Arab... 70 4e-10 emb|CBI31167.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|NP_187469.4| phototropic-responsive NPH3 family protein [Ara... 70 4e-10 gb|EXB75306.1| BTB/POZ domain-containing protein [Morus notabilis] 69 5e-10 ref|XP_002323684.2| hypothetical protein POPTR_0016s14670g [Popu... 69 5e-10 ref|XP_006374056.1| phototropic-responsive family protein [Popul... 69 5e-10 gb|EYU42051.1| hypothetical protein MIMGU_mgv1a003173mg [Mimulus... 69 7e-10 ref|XP_007033473.1| Phototropic-responsive NPH3 family protein i... 69 7e-10 >ref|XP_003623642.1| BTB/POZ domain-containing protein [Medicago truncatula] gi|355498657|gb|AES79860.1| BTB/POZ domain-containing protein [Medicago truncatula] Length = 704 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+A+LAEIAP+PCL+L+KF +IEIL D ARVIDDGL+RAI+I LK Sbjct: 452 VGQLIDAFLAEIAPDPCLSLQKFIALIEILPDYARVIDDGLYRAIDIYLK 501 >ref|XP_007140048.1| hypothetical protein PHAVU_008G080100g [Phaseolus vulgaris] gi|561013181|gb|ESW12042.1| hypothetical protein PHAVU_008G080100g [Phaseolus vulgaris] Length = 593 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = +2 Query: 323 CKVSMGMCYKAR*VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEI 502 C G K VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I Sbjct: 375 CSAGHGSLLK---VGQLIDAYLAEIAPDPYLSLQKFVALIEILPDYARVIDDGLYRAVDI 431 Query: 503 SLK 511 LK Sbjct: 432 YLK 434 >ref|XP_007208710.1| hypothetical protein PRUPE_ppa003095mg [Prunus persica] gi|462404352|gb|EMJ09909.1| hypothetical protein PRUPE_ppa003095mg [Prunus persica] Length = 605 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI+ YLAEIAP+PCL+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 382 VGRLIDTYLAEIAPDPCLSLQKFIAMIEILPDYARVIDDGLYRAVDIYLK 431 >ref|XP_006602729.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] Length = 598 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGLYRAVDIYLK 434 >ref|XP_006602728.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] Length = 608 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGLYRAVDIYLK 434 >ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X4 [Glycine max] gi|571479597|ref|XP_006587907.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X5 [Glycine max] Length = 548 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 325 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 374 >ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X3 [Glycine max] Length = 597 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 374 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 423 >ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] Length = 598 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 434 >ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] Length = 608 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 434 >gb|AAG51355.1|AC012562_16 hypothetical protein; 15198-13181 [Arabidopsis thaliana] Length = 612 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG++++AYLAEIAP+PCL+L KF +IEIL D ARV+DDGL+RAI++ LK Sbjct: 385 VGRIMDAYLAEIAPDPCLSLHKFMALIEILPDYARVMDDGLYRAIDMFLK 434 >ref|XP_004492590.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Cicer arietinum] Length = 609 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VGQLI+A+LAEIAP+P L L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 386 VGQLIDAFLAEIAPDPYLTLQKFIALIEILPDYARVIDDGLYRAVDIYLK 435 >ref|XP_002269960.2| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform 1 [Vitis vinifera] Length = 636 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI++YLAEIAP+P LNL+KF ++EIL D ARVIDDGL+RA++I LK Sbjct: 414 VGRLIDSYLAEIAPDPYLNLQKFMAMLEILPDYARVIDDGLYRAVDIYLK 463 >ref|XP_002884684.1| hypothetical protein ARALYDRAFT_478155 [Arabidopsis lyrata subsp. lyrata] gi|297330524|gb|EFH60943.1| hypothetical protein ARALYDRAFT_478155 [Arabidopsis lyrata subsp. lyrata] Length = 554 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG++++AYLAEIAP+PCL+L KF +IEIL D ARV+DDGL+RAI++ LK Sbjct: 327 VGRIMDAYLAEIAPDPCLSLHKFMALIEILPDYARVMDDGLYRAIDMFLK 376 >emb|CBI31167.3| unnamed protein product [Vitis vinifera] Length = 493 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI++YLAEIAP+P LNL+KF ++EIL D ARVIDDGL+RA++I LK Sbjct: 380 VGRLIDSYLAEIAPDPYLNLQKFMAMLEILPDYARVIDDGLYRAVDIYLK 429 >ref|NP_187469.4| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] gi|338819812|sp|Q9C9Z7.2|Y3857_ARATH RecName: Full=BTB/POZ domain-containing protein At3g08570 gi|332641126|gb|AEE74647.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] Length = 617 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG++++AYLAEIAP+PCL+L KF +IEIL D ARV+DDGL+RAI++ LK Sbjct: 390 VGRIMDAYLAEIAPDPCLSLHKFMALIEILPDYARVMDDGLYRAIDMFLK 439 >gb|EXB75306.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 605 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+L++AYLAEIAP+P L+L+KF IIEIL D ARV+DDGL+RA++I LK Sbjct: 381 VGRLMDAYLAEIAPDPYLSLQKFIAIIEILPDYARVVDDGLYRAVDIYLK 430 >ref|XP_002323684.2| hypothetical protein POPTR_0016s14670g [Populus trichocarpa] gi|550321520|gb|EEF05445.2| hypothetical protein POPTR_0016s14670g [Populus trichocarpa] Length = 607 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI++YLAE AP+P L+L+KFT +IEIL D ARVIDDGL+RAI+I LK Sbjct: 384 VGRLIDSYLAETAPDPYLSLQKFTAMIEILPDYARVIDDGLYRAIDIYLK 433 >ref|XP_006374056.1| phototropic-responsive family protein [Populus trichocarpa] gi|550321519|gb|ERP51853.1| phototropic-responsive family protein [Populus trichocarpa] Length = 547 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI++YLAE AP+P L+L+KFT +IEIL D ARVIDDGL+RAI+I LK Sbjct: 324 VGRLIDSYLAETAPDPYLSLQKFTAMIEILPDYARVIDDGLYRAIDIYLK 373 >gb|EYU42051.1| hypothetical protein MIMGU_mgv1a003173mg [Mimulus guttatus] Length = 603 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI++YLAEIAP+P L+L KF ++IE+L D ARVIDDGL+RAI+I LK Sbjct: 383 VGRLIDSYLAEIAPDPYLSLAKFISMIEVLPDYARVIDDGLYRAIDIYLK 432 >ref|XP_007033473.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] gi|508712502|gb|EOY04399.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] Length = 636 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 362 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 511 VG+LI+ YLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RAI+I LK Sbjct: 384 VGRLIDTYLAEIAPDPYLSLQKFVAMIEILPDYARVIDDGLYRAIDIYLK 433