BLASTX nr result
ID: Papaver27_contig00030970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00030970 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210400.1| hypothetical protein PRUPE_ppa000865mg [Prun... 55 8e-06 >ref|XP_007210400.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica] gi|462406135|gb|EMJ11599.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica] Length = 976 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 423 VVSEKQLVKHLQKEVARLEAEMITPDPSARSDTDALSRENDFDD 292 VVS+KQLVKHLQKEVARLEAE+ TPDPS D E + ++ Sbjct: 373 VVSDKQLVKHLQKEVARLEAELRTPDPSTEKDLKIQQMEMEMEE 416