BLASTX nr result
ID: Papaver27_contig00030792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00030792 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006664912.1| PREDICTED: post-GPI attachment to proteins f... 57 3e-06 ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins f... 57 3e-06 gb|AFK33317.1| unknown [Medicago truncatula] 57 3e-06 ref|XP_003620227.1| Post-GPI attachment to proteins factor [Medi... 57 3e-06 ref|NP_001054945.1| Os05g0220100 [Oryza sativa Japonica Group] g... 57 3e-06 ref|XP_006576320.1| PREDICTED: post-GPI attachment to proteins f... 57 3e-06 ref|XP_003562375.1| PREDICTED: post-GPI attachment to proteins f... 57 3e-06 ref|XP_003521884.1| PREDICTED: post-GPI attachment to proteins f... 57 3e-06 ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Popu... 57 3e-06 ref|XP_003528854.1| PREDICTED: post-GPI attachment to proteins f... 56 5e-06 ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins f... 56 5e-06 ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins f... 56 5e-06 ref|XP_002513401.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 ref|XP_002513400.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 ref|XP_002310105.1| Per1-like family protein [Populus trichocarp... 56 5e-06 emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera] 56 5e-06 >ref|XP_006664912.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Oryza brachyantha] Length = 351 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 +TIPLTYLWWSFIKDDAEFRTS +KK K Sbjct: 323 STIPLTYLWWSFIKDDAEFRTSTLIKKAK 351 >ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria italica] Length = 346 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 +TIPLTYLWWSFIKDDAEFRTS +KK K Sbjct: 318 STIPLTYLWWSFIKDDAEFRTSTLIKKAK 346 >gb|AFK33317.1| unknown [Medicago truncatula] Length = 119 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRT+ F+KK K Sbjct: 91 TTIPLTYVWWSFIRDDAEFRTARFLKKAK 119 >ref|XP_003620227.1| Post-GPI attachment to proteins factor [Medicago truncatula] gi|355495242|gb|AES76445.1| Post-GPI attachment to proteins factor [Medicago truncatula] Length = 342 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRT+ F+KK K Sbjct: 314 TTIPLTYVWWSFIRDDAEFRTARFLKKAK 342 >ref|NP_001054945.1| Os05g0220100 [Oryza sativa Japonica Group] gi|46981236|gb|AAT07554.1| unknown protein [Oryza sativa Japonica Group] gi|46981304|gb|AAT07622.1| unknown protein [Oryza sativa Japonica Group] gi|113578496|dbj|BAF16859.1| Os05g0220100 [Oryza sativa Japonica Group] gi|125551295|gb|EAY97004.1| hypothetical protein OsI_18926 [Oryza sativa Indica Group] gi|215768537|dbj|BAH00766.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630646|gb|EEE62778.1| hypothetical protein OsJ_17581 [Oryza sativa Japonica Group] Length = 349 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 +TIPLTYLWWSFIKDDAEFRTS +KK K Sbjct: 321 STIPLTYLWWSFIKDDAEFRTSTLIKKAK 349 >ref|XP_006576320.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform X2 [Glycine max] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 417 LTTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 +TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 317 VTTIPLTYIWWSFIRDDAEFRTSNLLKKAK 346 >ref|XP_003562375.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brachypodium distachyon] Length = 348 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 411 TIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TIPLTYLWWSFIKDDAEFRTS +KK K Sbjct: 321 TIPLTYLWWSFIKDDAEFRTSTLIKKAK 348 >ref|XP_003521884.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform X1 [Glycine max] Length = 343 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 417 LTTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 +TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 314 VTTIPLTYIWWSFIRDDAEFRTSNLLKKAK 343 >ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa] gi|118489817|gb|ABK96708.1| unknown [Populus trichocarpa x Populus deltoides] gi|222858923|gb|EEE96470.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa] Length = 348 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTYLWWSF+KDDAEFRTS +KK + Sbjct: 320 TTIPLTYLWWSFVKDDAEFRTSSLLKKAR 348 >ref|XP_003528854.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine max] Length = 343 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 315 TTIPLTYIWWSFIRDDAEFRTSNLLKKAK 343 >ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 2 [Vitis vinifera] Length = 342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFIKDDAEF+T+ +KKVK Sbjct: 314 TTIPLTYIWWSFIKDDAEFQTANLLKKVK 342 >ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 1 [Vitis vinifera] gi|296082755|emb|CBI21760.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFIKDDAEF+T+ +KKVK Sbjct: 351 TTIPLTYIWWSFIKDDAEFQTANLLKKVK 379 >ref|XP_002513401.1| conserved hypothetical protein [Ricinus communis] gi|223547309|gb|EEF48804.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 265 TTIPLTYIWWSFIRDDAEFRTSSLLKKAK 293 >ref|XP_002513400.1| conserved hypothetical protein [Ricinus communis] gi|223547308|gb|EEF48803.1| conserved hypothetical protein [Ricinus communis] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 300 TTIPLTYIWWSFIRDDAEFRTSSLLKKAK 328 >ref|XP_002310105.1| Per1-like family protein [Populus trichocarpa] gi|222853008|gb|EEE90555.1| Per1-like family protein [Populus trichocarpa] Length = 342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFI+DDAEFRTS +KK K Sbjct: 314 TTIPLTYIWWSFIRDDAEFRTSNLLKKTK 342 >emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera] Length = 342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 414 TTIPLTYLWWSFIKDDAEFRTSEFVKKVK 328 TTIPLTY+WWSFIKDDAEF+T+ +KKVK Sbjct: 314 TTIPLTYIWWSFIKDDAEFQTANLLKKVK 342