BLASTX nr result
ID: Papaver27_contig00029989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00029989 (637 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006376036.1| hypothetical protein POPTR_0013s08210g [Popu... 62 1e-07 ref|XP_002513823.1| hypothetical protein RCOM_1032650 [Ricinus c... 59 9e-07 ref|XP_007042057.1| Terminal EAR1-like 1, putative [Theobroma ca... 57 5e-06 >ref|XP_006376036.1| hypothetical protein POPTR_0013s08210g [Populus trichocarpa] gi|550325259|gb|ERP53833.1| hypothetical protein POPTR_0013s08210g [Populus trichocarpa] Length = 376 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/54 (50%), Positives = 40/54 (74%) Frame = -1 Query: 202 VMMKNIPTSISRSMLMDIVDQHCIEENKKAITMSNHDDHQDAILSEYDFLYLPM 41 VM++NIP +R MLM+ +D+HC+ EN+KA N D ++AI+S +DFLYLP+ Sbjct: 223 VMIRNIPNRYTREMLMEFLDRHCMMENEKAKKHQNSDSAKEAIVSAFDFLYLPI 276 >ref|XP_002513823.1| hypothetical protein RCOM_1032650 [Ricinus communis] gi|223546909|gb|EEF48406.1| hypothetical protein RCOM_1032650 [Ricinus communis] Length = 407 Score = 59.3 bits (142), Expect = 9e-07 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = -1 Query: 202 VMMKNIPTSISRSMLMDIVDQHCIEENKKAITMSNHDDHQDAILSEYDFLYLPM 41 +M++NIP R+ LMDI+D+HC EEN+KA S D I SEYDFLYLPM Sbjct: 257 LMIRNIPNQFERNKLMDILDRHCQEENEKAELRS------DPIKSEYDFLYLPM 304 >ref|XP_007042057.1| Terminal EAR1-like 1, putative [Theobroma cacao] gi|508705992|gb|EOX97888.1| Terminal EAR1-like 1, putative [Theobroma cacao] Length = 376 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = -1 Query: 202 VMMKNIPTSISRSMLMDIVDQHCIEENKKAITMSNHDDHQDAILSEYDFLYLPM 41 +M++NIP +R ML D +DQHC+ N+ + N D ++ +LS +DFLYLP+ Sbjct: 214 IMIRNIPNRYTREMLKDFLDQHCMLTNRDQVQSQNGDADEEPLLSAFDFLYLPI 267