BLASTX nr result
ID: Papaver27_contig00029216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00029216 (1088 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006591382.1| PREDICTED: arginyl-tRNA--protein transferase... 58 6e-06 ref|XP_003538457.1| PREDICTED: arginyl-tRNA--protein transferase... 58 6e-06 >ref|XP_006591382.1| PREDICTED: arginyl-tRNA--protein transferase 1-like isoform X2 [Glycine max] Length = 579 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 302 GYYIHLCNKMRYKAAYHPYKLLCPLRQE*V-FDVS 201 GYYIH CNKMRYKAAYHP +LLCPLR + V FD++ Sbjct: 409 GYYIHSCNKMRYKAAYHPSELLCPLRYQWVPFDIA 443 >ref|XP_003538457.1| PREDICTED: arginyl-tRNA--protein transferase 1-like isoform X1 [Glycine max] Length = 619 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 302 GYYIHLCNKMRYKAAYHPYKLLCPLRQE*V-FDVS 201 GYYIH CNKMRYKAAYHP +LLCPLR + V FD++ Sbjct: 449 GYYIHSCNKMRYKAAYHPSELLCPLRYQWVPFDIA 483