BLASTX nr result
ID: Papaver27_contig00028916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00028916 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311952.2| hypothetical protein POPTR_0008s02240g [Popu... 60 6e-07 ref|XP_006836062.1| hypothetical protein AMTR_s00114p00090820 [A... 59 1e-06 ref|XP_002524996.1| bile acid:sodium symporter, putative [Ricinu... 57 3e-06 ref|XP_002523789.1| bile acid:sodium symporter, putative [Ricinu... 56 7e-06 >ref|XP_002311952.2| hypothetical protein POPTR_0008s02240g [Populus trichocarpa] gi|550332221|gb|EEE89319.2| hypothetical protein POPTR_0008s02240g [Populus trichocarpa] Length = 347 Score = 59.7 bits (143), Expect = 6e-07 Identities = 37/92 (40%), Positives = 45/92 (48%), Gaps = 2/92 (2%) Frame = -2 Query: 347 GVCGC--FTPFFSKVILQLQLAPQEFVTRKLIEYQ*TRAVAR*RYSCWSTNTGMCQSLAG 174 G+C FTPF SK+ILQ+QL PQEFVT G Sbjct: 147 GICSILLFTPFLSKIILQIQLQPQEFVT-------------------------------G 175 Query: 173 LVVFSCMPTTLTSGVALTQIRQLNGL*CKILT 78 L +F CMPTTL+SGVALTQ+ N ++T Sbjct: 176 LAIFCCMPTTLSSGVALTQLAGGNSALALVMT 207 >ref|XP_006836062.1| hypothetical protein AMTR_s00114p00090820 [Amborella trichopoda] gi|548838484|gb|ERM98915.1| hypothetical protein AMTR_s00114p00090820 [Amborella trichopoda] Length = 431 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/81 (43%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = -2 Query: 350 FGVCGC--FTPFFSKVILQLQLAPQEFVTRKLIEYQ*TRAVAR*RYSCWSTNTGMCQSLA 177 FG+C FTPFFSK+ILQL+L PQEF+ Sbjct: 165 FGLCSILFFTPFFSKLILQLELIPQEFI-------------------------------R 193 Query: 176 GLVVFSCMPTTLTSGVALTQI 114 GL +F CMPTTL+SGVALTQ+ Sbjct: 194 GLAIFCCMPTTLSSGVALTQL 214 >ref|XP_002524996.1| bile acid:sodium symporter, putative [Ricinus communis] gi|223535740|gb|EEF37403.1| bile acid:sodium symporter, putative [Ricinus communis] Length = 423 Score = 57.4 bits (137), Expect = 3e-06 Identities = 34/81 (41%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = -2 Query: 350 FGVCGCF--TPFFSKVILQLQLAPQEFVTRKLIEYQ*TRAVAR*RYSCWSTNTGMCQSLA 177 FG+C TP+FS++ILQ+QL PQEFVT Sbjct: 140 FGLCSILFITPYFSRIILQIQLQPQEFVT------------------------------- 168 Query: 176 GLVVFSCMPTTLTSGVALTQI 114 GL +F CMPTTL+SGVALTQ+ Sbjct: 169 GLALFCCMPTTLSSGVALTQL 189 >ref|XP_002523789.1| bile acid:sodium symporter, putative [Ricinus communis] gi|223536877|gb|EEF38515.1| bile acid:sodium symporter, putative [Ricinus communis] Length = 409 Score = 56.2 bits (134), Expect = 7e-06 Identities = 33/73 (45%), Positives = 39/73 (53%) Frame = -2 Query: 332 FTPFFSKVILQLQLAPQEFVTRKLIEYQ*TRAVAR*RYSCWSTNTGMCQSLAGLVVFSCM 153 FTPFFS +ILQ++LAPQEFVT GL +F C+ Sbjct: 166 FTPFFSYLILQVRLAPQEFVT-------------------------------GLAIFCCV 194 Query: 152 PTTLTSGVALTQI 114 PTTLTSGVALTQ+ Sbjct: 195 PTTLTSGVALTQL 207