BLASTX nr result
ID: Papaver27_contig00028884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00028884 (890 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199762.1| putative prefoldin subunit 3 [Arabidopsis thali... 53 6e-06 ref|XP_006395057.1| hypothetical protein EUTSA_v10004957mg [Eutr... 53 6e-06 >ref|NP_199762.1| putative prefoldin subunit 3 [Arabidopsis thaliana] gi|79330420|ref|NP_001032045.1| putative prefoldin subunit 3 [Arabidopsis thaliana] gi|12230431|sp|P57741.1|PFD3_ARATH RecName: Full=Probable prefoldin subunit 3 gi|13878183|gb|AAK44169.1|AF370354_1 putative von Hippel-Lindau binding protein [Arabidopsis thaliana] gi|10177617|dbj|BAB10764.1| von Hippel-Lindau binding protein (VHL binding protein; VBP) like [Arabidopsis thaliana] gi|16323366|gb|AAL15177.1| putative von Hippel-Lindau binding protein [Arabidopsis thaliana] gi|222423655|dbj|BAH19795.1| AT5G49510 [Arabidopsis thaliana] gi|332008439|gb|AED95822.1| putative prefoldin subunit 3 [Arabidopsis thaliana] gi|332008440|gb|AED95823.1| putative prefoldin subunit 3 [Arabidopsis thaliana] Length = 195 Score = 53.1 bits (126), Expect(2) = 6e-06 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = -1 Query: 398 AYLQFLRDLVTVKQVTITLLYNWDVYQCRIKHV--TTIAVRDS 276 A LQFLRD VTV QVTI +YNWDV+Q R+K V T IAV DS Sbjct: 153 ADLQFLRDQVTVTQVTIARVYNWDVHQRRVKQVTPTAIAVADS 195 Score = 24.3 bits (51), Expect(2) = 6e-06 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 445 ARALLQKNIDNAKASM 398 A ALL+ N++NAKAS+ Sbjct: 133 ASALLKNNLENAKASL 148 >ref|XP_006395057.1| hypothetical protein EUTSA_v10004957mg [Eutrema salsugineum] gi|557091696|gb|ESQ32343.1| hypothetical protein EUTSA_v10004957mg [Eutrema salsugineum] Length = 195 Score = 53.1 bits (126), Expect(2) = 6e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -1 Query: 398 AYLQFLRDLVTVKQVTITLLYNWDVYQCRIKHVTTIAV 285 A LQFLRD VTV QVTI +YNWDV+Q R+K VT+ A+ Sbjct: 153 ADLQFLRDQVTVTQVTIARIYNWDVHQRRVKQVTSTAI 190 Score = 24.3 bits (51), Expect(2) = 6e-06 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 445 ARALLQKNIDNAKASM 398 A ALL+ N++NAKAS+ Sbjct: 133 ATALLKNNLENAKASL 148